current user: public




Query: PF03466.18; Q98I60_RHILO/88-294; LysR substrate binding domain, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst KDRPSGVLRVTTTVGLGAGWLTERVQEFIELYPEISLQLILANEELDLTMRQADCAIRLRQPQQPDLIQRRLFTVHFHLYAAPSYVAKHGKPASVSELRNHRIVTFGLPVPSHLSELNWLETVGDFEGGQRVPSLQINDILSIKRAVQGGAGIAMLPDYVINKDSGLVQLLPETEVPSFDTYFAYPDAMKNQAKLHVFRDFIIAKARLast
1 -108.000PF03466.18; Q98I60_RHILO/88-294; LysR substrate binding domain  ali  100  1KDRPSGVLRVTTTVGLGAGWLTERVQEFIELYPEISLQLILANEELDLTMRQADCAIRLRQPQQPDLIQRRLFTVHFHLYAAPSYVAKHGKPASVSELRNHRIVTFGLPVPSHLSELNWLETVGDFEGGQRVPSLQINDILSIKRAVQGGAGIAMLPDYVINKDSGLVQLLPETEVPSFDTYFAYPDAMKNQAKLHVFRDFIIAKAR 207
2 -7.940PF13531.4; A9BZ83_DELAS/51-277; Bacterial extracellular solute-binding protein  ali follow..  10  27........KVVTSRGASMGNAQDSIPSRLARGEQFDIVILADGALDNLAAQGKVEAGSRVDLARSMIGMSVRKGTPKPDISTVDALKQ--------TLLDAKTIAYSASASGTYLANELFPRLG--VAEQMKGKATRILSERVGAVVLRGIGFQQVSELLPFKELEFVGPLPDEVQQRVFFSAGVATGAKSPETARHLIRFLAAP.. 216
3 -7.670PF07090.9; A9CEM2_AGRFC/4-254; Putative glutamine amidotransferase  ali follow..  13  3......................................LLVGESWVSSATKGFDQFGSVTFHLGAEPLVKALEGSEYELTYMTAHDAVEKFPFEMAGLDAYDAIILSDIGSNSL---------LLPPAVWLHSKTVPNRLKLIKAWVEKGGGLLMVGGYFSFQGIDVEDTLP................................... 138
4 -7.320PF13343.4; B3E2B9_GEOLS/96-336; Bacterial extracellular solute-binding protein  ali follow..  10  3...............FPDIIISPGFNSLFE--RPFVERFIQTNRFVSVNDYAGDRHLSALGVCDPTGHYTMLAMNLLVPVVDHRRLGGRPVPRCWADLLKREYLAIRGHKDGTFCELAIYKDTGVEGLRTMGRNVRWHPSQMVKAALGSSPAISVMPLFFLVGKEQYSIIWPDDGALISPVTML--VKTEKRAELDDLLAFWAGP.. 202
5 -7.230PF12849.5; B6YQR6_AZOPC/32-299; PBP superfamily domain  ali follow..  13  5GDTLSGKVRIS-----GSFALYPMMETFKILHPDVSFDISGGGAMTDVLNEMVDVGMVSREIYSQEAFCILVAKDAVVPIVNVA----NEKIKTWGAVSKTCVHVFTRSDACGAAETWFNARQEDLKATSIFGDPGIADAIQKDKFGIGYNNISYAYNRKTKKLNEGLAIIPRYPSPPARYLYLVTKGKPTSPALISFLKYILSE.. 268
6 -6.810PF14424.4; G7M3G9_9CLOT/245-372; The BURPS668_1122 family of deaminases  ali follow..  15  88VLKNEGKLILYSKWEPCPS-CYFVISQFCKKHPNIKVQVK....................................................................................................................................................................... 126
7 -6.510PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II  ali follow..  13  29EVKGFGRQKGHTELYRGAEYVVDFL-------PKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQA.................................................................................................................................... 96
8 -6.340PF11445.6; E5AS28_BURRH/15-195; Protein of unknown function (DUF2894 topsan)  ali follow..  12  109.....................PATLDYFRKTWAKVRIEKQLRQSLNQVPRNA-------GPLNSSSLVHRSLSLMREL---SPGYLQQF...................................................................................................................... 166
9 -6.300PF08210.9; F6XHB3_MACMU/37-207; APOBEC-like N-terminal domain  ali follow..  13  65..SPNTDYQVTWYTSWS---CAGEVAKFLARHNNVMLTIYTA-RLYYSQYPNYQQGLRSLSEKGVSV---KIMDYEDFKYCWEKFVYDDGEPFKPKGLKTS.......................................................................................................... 161
10 -6.290PF03358.13; A8LBH0_FRASN/3-150; NADPH-dependent FMN reductase  ali follow..  10  4.....GIIIGSTRPNRNGEQVAKWVFDVASKRTDAEFELVLLDYPLPHLDEPLPPSLGQYQNEHTKRWAAKIASFDGFVMVTPEY--NHSTSGVLKNAIDY.......................................................................................................... 98

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.