current user: public




PF03466
Query: PF03466.15; Q98I60_RHILO/88-294; LysR substrate binding domain, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst KDRPSGVLRVTTTVGLGAGWLTERVQEFIELYPEISLQLILANEELDLTMRQADCAIRLRQPQQPDLIQRRLFTVHFHLYAAPSYVAKHGKPASVSELRNHRIVTFGLPVPSHLSELNWLETVGDFEGGQRVPSLQINDILSIKRAVQGGAGIAMLPDYVINKDSGLVQLLPETEVPSFDTYFAYPDAMKNQAKLHVFRDFIIAKARLast
1 -111.000PF03466.15; Q98I60_RHILO/88-294; LysR substrate binding domain  ali  100  1KDRPSGVLRVTTTVGLGAGWLTERVQEFIELYPEISLQLILANEELDLTMRQADCAIRLRQPQQPDLIQRRLFTVHFHLYAAPSYVAKHGKPASVSELRNHRIVTFGLPVPSHLSELNWLETVGDFEGGQRVPSLQINDILSIKRAVQGGAGIAMLPDYVINKDSGLVQLLPETEVPSFDTYFAYPDAMKNQAKLHVFRDFIIAKAR 207
2 -13.200PF12727.2; A0LFW2_SYNFM/425-616; PBP superfamily domain  ali follow..  14  2.........................NEIKRRDGRMQLSSGNVGSLMAVRRAQTHLA-PATGGYNHSYVERYLQGVPIRLVTQQGLLVRRGNPAGVRGVRD-AFINRQGGSGTRILFDYCLRKEELAPEEIRGYDQEEFTHMAIAVTVLSGRADAGMAIFAAARALGLDFI----PVAEERYDLVIPESFWEDPKMGLLMEIIT.... 192
3 -12.100PF12849.2; A1EKQ7_VIBCH/24-252; PBP superfamily domain  ali follow..  12  2SSADDARIRLATTTSTYDSGLLDYLLPKFEQDTGYKVDVIATGKALKMGENGVDLVMTHAPKAEASFVEAGFGVLPRKLMYNDFVVGPESDPAKIADEKN-VFISRGDDSGTHKKELGIWAQNKIEPNFGGYRSIGQGMGPTLNMASEMQTLTDRGTWLAYNNKLALKILFEGDEQLFNPYQVIIVNPERYPHAAKVFSDWLVN... 227
4 -9.300PF07090.6; Q4ZYE2_PSEU2/4-184; Protein of unknown function (DUF1355 topsan)  ali follow..  13  1...................................SVLLAGESWVSTSTHKGFDQFDSVTAHNGARRLLAEMADSDYQITQMCADQAQTDFPATVEALSQYQAVILSDIGANTL---------LLHPDTWLRGKRTLNRLKALREYVLQGGALMMVGGYFSFQGTPVEEVLP................................... 138
5 -8.480PF13343.1; B3E2B9_GEOLS/96-336; Bacterial extracellular solute-binding protein  ali follow..  10  18................................RPFVERFIQTNRFVSVNDYAGDRHLSALGVCDPTGHYTMLAMNLLVPVVDHRRLGGRPVPRCWADLLKREYLAIRGHKDGTFCELAIYKDTGVEGLRTMGRNVRWHPSQMVKAALGSSPAISVMPLFFAVGKEQYSIIWPDDGALISPVTML--VKTEKRAELDDLLAFWAGP.. 202
6 -7.390PF03358.10; A8LBH0_FRASN/3-150; NADPH-dependent FMN reductase  ali follow..  8.....GSTRPNR-----GEQVAKWVFDVASKRTDAEFEVDLLDYPLPHLDEPLPPSLGQYQNEHTKRWAAKIASFDGFVMVTPEY--NHSTSGVLKNAIDYLFSEWA----------------NKAVGFVSYGGAGGARAAEHLRLIVGELQMADVRQ................................................. 139
7 -7.300PF11445.3; A4LU37_BURPS/12-235; Protein of unknown function (DUF2894 topsan)  ali follow..  17  150.....................PELLDYFRETWSKLSADSQLRASLEQVPKNA-------GPLNSSSLVHRSLSLMREL---SPEYLRQF...................................................................................................................... 207
8 -6.650PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali follow..  14  34.....GRQKGHTELYRGAEYVVDFL-------PKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQA.................................................................................................................................... 96
9 -6.630PF09399.5; Q3I5K9_CVHSA/1-97; SARS lipid binding protein  ali follow..  19  17................................PQIQLTITRMEDAVVHGQNNADIILRLGSQLSLSMVRKDSNSLKAREFLSTPIVAEMTKLATTEELPDEFVV....................................................................................................... 93
10 -6.290PF05268.6; VG38_BPM1/1-262; Phage tail fibre adhesin Gp38  ali follow..  12  8.....GWIGSSAANETGQRWMSQAAGQLRLGVP-----------MSQFAGRSREIIHTLGADHNFNIVFNITGDLVSYSKDVPLFFMYGDTPNEYVQLNIHGVTMYGRGGNGGSNS----SAGGHCIQNNIGGRLRINNGGAIAGGGGGGGGGYW.................................................... 161

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Bourne PE, Allerston CK, Krebs W, Li W, Shindyalov IN, Godzik A.,Friedberg I, Liu T, Wild D, Hwang S, Ghahramani Z, Chen L, Westbrook J. The status of structural genomics defined through the analysis of current targets and structures. Pac Symp Biocomput. 2004;:375-86.