current user: public




Query: PF03205.12; Q1GYX4_METFK/10-150; Molybdopterin guanine dinucleotide synthesis protein B, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst VLGFCAYGSGSGKTTLLTRLIPVLTARGLRISVIKHAHHKFDVDKPGKDSYRLREAGAVQTLVASDIRWALMTERQRIPTQQNEPANLPELLSQLDPDVVDLVLVEGFKQADIDKIEIHRPSLGYPLLAPEDRHIIAVAADLast
1 -94.200PF03205.12; Q1GYX4_METFK/10-150; Molybdopterin guanine dinucleotide synthesis protein B  ali  100  1VLGFCAYGSGSGKTTLLTRLIPVLTARGLRISVIKHAHHKFDVDKPGKDSYRLREAGAVQTLVASDIRWALMTERQRIPTQQNEPANLPELLSQLDPDVVDLVLVEGFKQADIDKIEIHRPSLGYPLLAPEDRHIIAVAAD 141
2 -13.800PF13500.4; B1XHZ8_SYNP2/6-216; AAA domain  ali follow..  21  3.IVVASTEPYSGKSAVLLGLVQSLKQKGISVAYSKHDEQNGRFTRIEDDLRFLGEAGLKETEVRSPVLFLDEATVAQRLTGQDQTDYPQKLKDDLGAIASDITFIEA.................................. 115
3 -12.100PF09140.9; Q9A6C9_CAUCR/5-268; ATPase MipZ  ali follow..  18  2VIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVI-------DLDLRQRTS-RRAWLDNKKIELPEPLALNLSDNDVALAERPEEEAGFEAAFARAM-AECDFILID................................... 106
4 -11.900PF07015.9; Q1M9M0_RHIL3/1-231; VirC1 protein  ali follow..  23  3LVTCCSFKGGAGKTTALMGLCSALAADGKTIALF-------EADENR-----------------PLSKWKENATRRNAWDPTDELPLLEVAYEEAAGRGFDYCLVE................................... 90
5 -11.400PF00485.16; KPPR_SYNY3/10-192; Phosphoribulokinase / Uridine kinase family  ali follow..  16  1LIGVAG-DSGCGKSTFLRRLTDLFGEEFMTV-ICLDDYHSLDRQGRKAAGVTALDPRANNFDLMYEQIKTLKSGQSIMKPIYNHETGLLDPPEKVEPN--KVVVIEGLHPLYDERVR........................ 113
6 -10.900PF13238.4; Q5ZL96_CHICK/5-160; AAA domain  ali follow..  19  1.IGIGG-VTNGGKTTLTRRLMQALP----NCSVVHQDDFFKPQDEDGFKQYDVISALDMEAMMSTINAWIKNPVKFERSHGINNTLDAQISPDRGRDEAVHILIVEGFLLYTYRPL......................... 115
7 -10.100PF06564.10; A7MKN7_CROS8/1-234; Cellulose biosynthesis protein BcsQ  ali follow..  17  3VLALQGVRGGVGTTSLTAALGWALHQLGESVLVIDRLSFNIDFDHDGWARALLDDKPWQSTAWRYAPGLDVL-ALRQTERENDVTPALGAFAQHLHSGQWRWILLD---------LPCGFDAVTRSLLQVADRTLCVVQPD 148
8 -9.880PF10649.7; H0PT62_9RHOO/9-167; Protein of unknown function (DUF2478 topsan)  ali follow..  17  1.IAAIVYRPTDHIEPVLEQAAQRLAERGVRLGGILQHDLPTCIE---------DPCGMELEDLASGERFALSQELGSGSEACRLDPNAAVAIRRALESGVELVFVNKF------AQEASGSGLRSEMAMAVSSGTPVITA. 129
9 -9.310PF13614.4; R7M636_9CLOT/2-188; AAA domain  ali follow..  16  3IIAVVNQKGGVGKTTTSINLSASLGLLGKKVLIV-------DLDSQGNAT---TGVGIDKKDISASIYEVLTMRADHDAIIKTKSRNLSIIPAYLNLAGVQVEFFEMERKFAEQNIKFSKVLRLKEELYKIKDDYDYILID 134
10 -9.270PF02606.12; LPXK_SHEAM/15-336; Tetraacyldisaccharide-1-P 4`-kinase  ali follow..  19  46........GGSGKTPTVLYLIELLRREGWRPGVISRGY--------ASFDGELDVVAGMSPAQVGDEPAMIAMRTGIPMVVGRNRIKAAHKL--LQCHDVNVILCDGLQHYALER.......................... 144

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.