current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

PF03205
Query: PF03205.9; Q9FLE2_ARATH/115-230; Molybdopterin guanine dinucleotide synthesis protein B, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst PRVIIVGDIDSGKSTLAKMLLNWAVKDGWKPTFVDLNVGQSSITIPGTIAAAPIKMLVDPVEGFPLDKALIHYFGLTNPSVNLRLYRTLVEELARELKEEFSANAESRASGMVIDTLast
1 -69.700PF03205.9; Q9FLE2_ARATH/115-230; Molybdopterin guanine dinucleotide synthesis protein B  ali  100  1PRVIIVGDIDSGKSTLAKMLLNWAVKDGWKPTFVDLNVGQSSITIPGTIAAAPIKMLVDPVEGFPLDKALIHYFGLTNPSVNLRLYRTLVEELARELKEEFSANAESRASGMVIDT 116
2 -27.400PF03029.12; O01426_CAEEL/6-251; Conserved hypothetical ATP binding protein  ali follow..  13  1....VIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANCNWLLQKIEANHKKY--------------LIIDC 98
3 -18.600PF13671.1; B2JHT3_BURP8/20-178; AAA domain  ali follow..  17  1.LVFICGHAGTGKTTLAKRLIGPLKATGEACCLLDKDTLYGVYSAAAIGAL-----------------------TGDPNDRDSPLFLQHFRDPEYRGLFDTAAENLRLGIGVIAVG 93
4 -15.700PF13479.1; Q4EAN1_9RICK/15-248; AAA domain  ali follow..  14  5.KMVIFGPYGIGKTSLLKTIDE-------PTLCLDFEAGLLAVQ---STEIRTWNEARDIACLIGGPNPALKSDQAYSQRH--------YEHVSSKYKDFSSEFSKYRC--IFVDS 104
5 -15.200PF13521.1; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  34  1.KVVLFGPESTGKTTLARELARHY............................................................................................ 23
6 -15.100PF07015.6; Q1M9M0_RHIL3/1-231; VirC1 protein  ali follow..  17  2QLVTCCSFKGAGKTTALMGLCSALAADGKTIALFEADENRP........................................................................... 43
7 -15.000PF06414.7; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  17  14PKAIILGQPGSGKGSLARAADV---ELGRDVVLIDPDELRNAHPEVSALR-----------------------------NAHPYTWSGYTHSDASQWADELLQVTIEGKKNLIFDT 98
8 -14.700PF07931.7; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  24  3.IVLLNGVGSAGKSSIARALQTITAAPF---LHVQMD............................................................................... 35
9 -14.600PF13207.1; B2WP20_PYRTR/6-173; AAA domain  ali follow..  22  1.IIGLYGISGSGKSYLLNHVKTEIALQAQRFAFYDGS............................................................................... 36
10 -14.600PF01591.13; F262_BOVIN/27-250; 6-phosphofructo-2-kinase  ali follow..  19  15.LIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLG............................................................................... 50
11 -14.600PF08433.5; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  40  2PLVVITGLPASGKSTRARQLRDHFVERGRKVHLISEN............................................................................... 38
12 -14.400PF09140.6; A5EKW2_BRASB/13-276; ATPase MipZ  ali follow..  20  1.HVVVLGNEGSGKSTTALHIAVALLKAGQRVATIDLDSRQQSFT-----HYINNRSAWARRTGLHLELPTHYCIKLGQTLQIDENEKAEFQQFMEAVCSVEHAFD------IVVDT 107
13 -13.500PF06745.8; O29463_ARCFU/20-274; KaiC  ali follow..  18  34.VMNITGVPDTGKSLLAEQFAITQAGSGYRVLYVTVESPANF------LYTAMKERSEAMGVDFTKVESNVVVIDASESDELRENPKALMETMAYAIKEK-------KVTNTIIDS 135
14 -13.500PF08303.6; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  21  1.LLVTIATIGCGKSTVSLTLNELF---PESWGLVVND............................................................................... 33
15 -13.200PF13401.1; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  24  7..LLVCGPTGAGKTTLAKFMVENAHSQSHAEMELN................................................................................. 39
16 -13.200PF05707.7; Q38198_9VIRU/7-180; Zonular occludens toxin (Zot)  ali follow..  11  2.ISLLTGLPGSGKSLRIIQAIRYLMDKGAHVYVCNID---QDLPAGSILFVDEAQHFFPARRGGDPVETIKAMSTIRHDGVRLVLATQQPNYLDTYLRGLVGYHEHLLR....... 122
17 -13.200PF02374.10; ASNA_HUMAN/37-340; Anion-transporting ATPase  ali follow..  13  3.WIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNKVKGYDNLFAMEIDPSLGVAELPEFFEEDNMLSMGKKMMQEAMSAFPGIDEAM-SYAEVMRLVKGMNFSVVVFDT 131
18 -12.900PF03266.10; NTPTH_METS5/13-164; NTPase  ali follow..  39  1.RLFITGRPGVGKTTLIKGLVSEL............................................................................................ 23
19 -12.600PF04665.7; A7XCQ5_9POXV/6-246; Poxvirus A32 protein  ali follow..  22  15.RLALVGGSGSGKTAYLLSLFNTLVEQYRHIFLFTPVYNSE........................................................................... 54
20 -12.400PF13238.1; A5UL64_METS3/4-148; AAA domain  ali follow..  31  1..VVLTGIPGSGSTTLLNKALEEV............................................................................................ 22
21 -12.300PF10662.4; A5ZM04_9FIRM/1-141; Ethanolamine utilisation - propanediol utilisation  ali follow..  23  3.KVFLMGRSEAGKTSLTQALKGEELHYHKT----YTNSNEDTIDSPG..................................................................... 45
22 -12.200PF04275.9; A4IGD4_DANRE/12-127; Phosphomevalonate kinase  ali follow..  1....FSGKRKSGKDYVTDLIQKRLTAEICCILRLS-APLKEQYAKDHNLDYEELMGSGQYKESYR---ADMIHWGEMKRQEDSGFFCRLAIK-------------HATQPVWIIS. 94
23 -12.200PF00910.17; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  20  1..VYAYGESRTGKTLVVDKLITDFQNH......................................................................................... 25
24 -11.700PF06564.7; A6TFD7_KLEP7/1-243; YhjQ protein  ali follow..  13  2AILGLQGVRGTGVTSITAALAWALQLLGESVLAIDASP.............................................................................. 40
25 -11.600PF00142.13; NIFH1_RHOCA/5-277; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family  ali follow..  26  2.QIAFYGKGGIGKSTTSQNTLAALVEMGQKILIVGCDPKADS.......................................................................... 42
26 -11.600PF04670.7; Q9VHJ4_DROME/4-230; Gtr1/RagA G protein conserved region  ali follow..  15  1.KVLLMGKSGSGKTSMRSIIFANYIARDTTRLGATIDVEHSHVRFLGNLVLNL............................................................... 52
27 -11.400PF13614.1; Q28JF6_JANSC/100-250; AAA domain  ali follow..  2.RLAVTSPASCGKTTMALNLLGFTRQPDIRVMLIELDLRRPSLGLQLNNDITEVLRGDVSFHEHAFRFGKNVTIRNVSKDPTSILLGPTTHQILEDIEATYDPD-------LMFDL 119
28 -11.200PF01121.15; COAE_HAEIN/3-181; Dephospho-CoA kinase  ali follow..  15  2.IVGLTGGIGSGKTTIANLFTDL------GVPLVDADVVAREVVAKDSPLLSKIAQILTEQGELNRAALRERVFNHDEDKLWLNNLLHAIRERMKQKLAEQTAPYTLFVVPLLIEN 116
29 -11.200PF09439.5; SRPB_YEAST/36-221; Signal recognition particle receptor beta subunit  ali follow..  19  4PSIIIAGPQNSGKTSLLTLLTSAADYDGSGVTLVDF-PGHVKLRYKLSDYLKTRAKFVKG---------LIFMVDSTVDPKKLTTTAEFLVDILSI-----TESSCENGIDILI.. 116
30 -11.100PF00485.13; KPPR_SYNY3/10-192; Phosphoribulokinase / Uridine kinase family  ali follow..  13  1.LIGVAGDSGCGKSTFLRRLTDLF--GEEFMTVICLD-AGVTALDPRANNFDLMYEQIKTLKSGQSIMKPIYNHETGLLDPPEKVEPNKVVVIEGLHPLYDERVRELVDFGVYLDI 124
31 -11.100PF03308.11; Q9YBB4_AERPE/19-287; ArgK protein  ali follow..  13  31.VIGFTGIPGAGKSTLVSRVITGLRRRGYRVAVVAIDPTSPFSGGSIMGDRLRMQEHAADPGVFIRSIPTRGIKG-----------------LSMAALAMIEVFDAMGYDKIIIET 129
32 -11.100PF06309.6; O45271_CAEEL/5-130; Torsin  ali follow..  16  52PLVLSFGGPGTGKNYVTEIIAKNTFRSGLQSPYVKYFVATKDFPNNKHIEDYKLKLKEQLIQSADGCDRSIFVF.......................................... 126
33 -10.800PF04548.11; Q8R379_MOUSE/9-219; AIG1 family  ali follow..  16  2.RIVLVGKTGSGKSATANTILGQKR-KERDLLVVDT-PGLFDTKVKLETTCLEISRCVLQSC-----PGPHAIILVLQLNRFTVEEQETVIRIKAIFGEEVMKYM------IVLFT 124
34 -10.600PF04310.7; MUKB_ECOLI/1-227; MukB N-terminal  ali follow..  21  29.VTTLSGGNGAGKSTTMAAFVTALIPDLTLLHF................................................................................... 60
35 -10.600PF13191.1; B3QEJ6_RHOPT/306-495; AAA ATPase domain  ali follow..  18  27.WVLISGYSGAGKSSVVSELRKSLAPTNGWFIAGKFDQYKRDIPFATLAQA................................................................. 76
36 -10.600PF01745.11; IPT_RHIRD/1-235; Isopentenyl transferase  ali follow..  17  2DLRLIFGPTCTGKTSTAIALAQQVLSLDRVQCCPQLSTGSGRPTVEELKGT................................................................. 56
37 -10.400PF01580.13; SFTA_BACSU/595-787; FtsK/SpoIIIE family  ali follow..  10  39PHGLIAGATGSGKSVCINTILVSLLADPSEVKVLLIDPKMVELAPYNKIPHLVSPVITDAKAATA-----ALKWVVEEMERRYELFAHSGVRDIDRFNQLTAEHQMGEKLPYLV.. 149
38 -10.200PF00735.13; SEPT2_MOUSE/34-313; Septin  ali follow..  12  7..LMVVGESGLGKSTLINSLFLTDLYPERIIPGAAEKIERTVQIEASTVEIEE--------RGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHI.... 108
39 -10.100PF13555.1; Q0A6A1_ALHEH/19-80; P-loop containing region of AAA domain  ali follow..  35  26..SLLTGDIGSGKSTLVDAITTLLVPAQRI...................................................................................... 53
40 -10.100PF01695.12; Y4IQ_RHISN/60-238; IstB-like ATP binding protein  ali follow..  26  51..ILLFGPPGGGKSHLAAAIGLALIENGWRVLFTRT................................................................................ 84
41 -10.000PF06431.6; Q8JUD5_POVJC/266-682; Polyomavirus large T antigen C-terminus  ali follow..  23  158..WLFKGPIDSGKTTLAAALLDLC---GGKSLNVNMPLERSNFELGVGIDQFMV-----VFEDIKGTGAESRDLPSGHGISNLDCLRDYLDGSVKVNLERKHQNKRTQVFPPGIVT 263
42 -10.000PF01583.15; PAPS1_HUMAN/51-209; Adenylylsulphate kinase  ali follow..  25  4.TVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGD............................................................................... 39
43 -9.890PF05272.6; Q9T1U5_BPAPS/448-641; Virulence-associated protein E  ali follow..  17  54.VPILVGAQGSGKSSGVAALSDDLARKMRGCLVAEIS-TKELESIKAFVTRTHEKWIPKFKEFATQFPRRSLSIGTTNEDE................................... 153
44 -9.860PF05673.8; Q0K6N5_CUPNH/29-287; Protein of unknown function (DUF815 topsan)  ali follow..  22  61..VLLTGARGTGKSSLIKACLNAFVRDGLRLVEVDKD------------DLGDLGDIVELVAQRPER---VIFCDDLSFEEGESGYKSLKSALDGSVAAQSDN............. 147
45 -9.830PF07652.9; Q32ZD8_9FLAV/1675-1822; Flavivirus DEAD domain  ali follow..  11  5QLIVLDPHPGAGKTRVLPEFIRQAVERRLWTLALA----------PTRVVAAEMAEALN-------GLPVRYLTPAVIQQHTGKEIVDLMCH-ATFTMRLLSGGRVPNYNMFIMD. 102
46 -9.830PF12846.2; A4JVD5_BURVG/498-898; AAA-like domain  ali follow..  16  4..TLLFGGPGNGKSVLANRLNLEMCLLPRLPYIGVIDIGISSTGFISLVKDSLPEHLKHLAVYVRLQNREDYGINRFPLPREREQMKNFLVALATPANRGKPHDYMDDFAGRVIDL 128
47 -9.810PF13481.1; Q7U700_SYNPX/79-275; AAA domain  ali follow..  37.LTLVVALQKVGKSAVVCNILGELAKPCPKVIIVGTDQPLADWR---EVMVPNGLMIRTDLDNYRVCDPVVRLYTREHGLHLDEAGIEKITADCEQNPWAV----------LVLDA 151
48 -9.780PF10649.4; A6X300_OCHA4/7-165; Protein of unknown function (DUF2478 topsan)  ali follow..  12  1.LAAILAAKDVPVDQLLAGVAHRARQAGLRVAGFLQHRESNTDECCRDIEIEHIGTGVTQIISQSLGS------GSKGCRLDPAALADVAGSLLAELDSGAD---------LILNR 101
49 -9.690PF01443.13; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  25  1..VLVDGVPGCGKTKEILSRVN.............................................................................................. 20
50 -9.650PF07088.6; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  12  12.TLLINGAPGTGKTLFTIRGLD-VLDRDSDVLYVSTRVDQETV------MYFADHSSLDTTAILDLFQDPFELPLDVDVPFEKLDLDSLLEWIQEINAAT-------TQLTIAFDS 114
51 -9.640PF08477.8; Q8LBR4_ARATH/108-221; Miro-like protein  ali follow..  13  1.KISLLGDPEIGKTSFLAKYVGEEKEVEMRELEKGINCTDKTLYMGG..................................................................... 46
52 -9.580PF07724.9; Q7PAG5_RICSI/595-759; AAA domain (Cdc48 subfamily)  ali follow..  13  6..FLFLGPTGVGKTELTKALAGFLFDDRNAILRIDMSEYMEKHAPPGYIGYDQGGVLTEAVR----RRPYQVILFDEVEKAHPDIFNIMLQILDEGRLTDSQGITVDFKNTIIVLT 122
53 -9.520PF03215.10; RAD17_HUMAN/83-593; Rad17 cell cycle checkpoint protein  ali follow..  14  49SILLITGPPGCGKTTTLKILSKEH--INPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDL-HTLHEVLRKYVRIGRCPLIF.. 174
54 -9.480PF05705.9; A8WVS3_CAEBR/69-317; Eukaryotic protein of unknown function (DUF829 topsan)  ali follow..  14  1PVVLMVGWAGANPKHIDKY-IKIYNDEGYRVVSLCPPCYHYSIPNSRV-LFRAVDSKAGDFRSFSQCPIVIHSFSMNG--------VRGLISFWKWTEAEEKPELRGRIKGIIFDS 112
55 -9.470PF14516; B0C1H3.1/102-434; AAA-like domain  ali follow..  14  34..IRIKAAKGMGKTSLVNRILKTAEAHPLQTLYLDFQ----------WASQASINNLERFLRWFCFQMGRQLGLDNQLDDYWDTELLTSIDNCSQYFEDYLLPNIEAPLV-LALD. 135
56 -9.460PF07728.9; Q82S33_NITEU/475-632; AAA domain (dynein-related subfamily)  ali follow..  32  2..LILQGPPGTGKTWLAKRLAFALMKDDSKVRAVQFHPN............................................................................. 40
57 -9.430PF05872.7; Q8YFZ2_BRUME/11-503; Bacterial protein of unknown function (DUF853 topsan)  ali follow..  18  24..GLVTGATGTGKTVSLQVLAESFSAAGVPVFCAD................................................................................. 56
58 -9.430PF01935.12; A3DEJ1_CLOTH/136-414; Domain of unknown function DUF87 topsan  ali follow..  17  30..LAVLAMTGSGKSYTVGRIIERLVAEMNGTVVV-FDV-HGEYG........................................................................ 69
59 -9.420PF05729.7; Q9GJD8_RAT/339-510; NACHT domain  ali follow..  30  2.VVAVLGKAGQGKSHWARTVS............................................................................................... 21
60 -9.320PF13604.1; B9QRK8_9RHOB/353-542; AAA domain  ali follow..  13  20..ASVVGRAGAGKTTMMKAAREVWEANGYQVVGA----------ALAGKAAEGLEKEAGIASRTLASWQLSWGRGEGLPDKKSVFVIDEAGMVDSRQMSVFVETIAKAGAKLVL.. 121
61 -9.080PF10236.4; Q755C9_ASHGO/113-434; Mitochondrial ribosomal death-associated protein 3  ali follow..  32  21.RVILTGQPGVGKSTLLAQAQVAAFEKGSVIINIS................................................................................. 54
62 -9.030PF02367.12; Q9Z7P7_CHLPN/14-136; Uncharacterised P-loop hydrolase UPF0079 topsan  ali follow..  14  17.VLLLFGDYGAGKTEFVRGIVSGYLGDTIAEEVAS................................................................................. 50

FFAS is supported by the NIH grant R01-GM087218-01
6 1 2 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.