current user: public




Query: PF02641.13; G7V719_THELD/8-104; Uncharacterized ACR, COG1993, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst QLLRIFIGESDKYKGKPLYEAIVNRAKELSMAGATVLRGILGFGAHSRLHSAKILRLSEDLPVVIEIVDTPERIQAFLPHLDEMITEGLVTLEKVQVLast
1 -61.800PF02641.13; G7V719_THELD/8-104; Uncharacterized ACR, COG1993  ali  100  1QLLRIFIGESDKYKGKPLYEAIVNRAKELSMAGATVLRGILGFGAHSRLHSAKILRLSEDLPVVIEIVDTPERIQAFLPHLDEMITEGLVTLEKVQV 97
2 -7.480PF13808.4; I3Y8A3_THIV6/10-97; DDE_Tnp_1-associated  ali follow..  2EHFTSLEDHRIERRKRHALADLVLLTICAVVSGTNGWEAIEDFGHEKLDWLRQFAPFENGVP-------SHDCMANVIARLSPKGFQACLL...... 85
3 -6.870PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II  ali follow..  17  11...................DDVRESLSEIGVQGITVTE-VKGFGRHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFV 90
4 -6.670PF11582.6; Q89MS9_BRADU/2-103; Protein of unknown function (DUF3240 topsan)  ali follow..  17  6.CLSLILARK-------LREELLDFLSEQQTSGFTVSD-AAGHGSGVQLPTAAERVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNLVYWIAPV 95
5 -6.320PF02606.12; LPXK_SHEAM/15-336; Tetraacyldisaccharide-1-P 4`-kinase  ali follow..  16  49.............GKTPTVLYLIELLRREGWRPGVISR---GYGASFDVVAGMSPAQVGDEPAMIAMVVGRNRIKAAHKLLQCHDVNVILCDDGLQ. 138
6 -6.200PF12537.6; Q0UJI5_PHANO/200-267; The Golgi pH Regulator (GPHR) Family N-terminal  ali follow..  17  1..................HTFSEGCLERIGIIGISLMASLAGFAAISSLWQ--TFGVKYRPVTESDIARKQAGIQATNDMLLT.............. 63
7 -6.110PF07489.9; A0A025FY19_ECOLX/326-538; Translocated intimin receptor (Tir) C-terminus  ali follow..  23  9.......QKYDEQHAKREQEMSLSSGVGYGISGALILGGGIGAGVTAALHRKN............................................ 54
8 -5.910PF07482.9; Q6N2Y3_RHOPA/338-451; Domain of Unknown Function (DUF1522 topsan)  ali follow..  17  42...TIYLGTSNTFTNATVGDVLTSIDLASGVKSATISGGIATFGTASSISGAGVVTLNSSTGADLHVTGPAD......................... 113
9 -5.770PF06141.9; M9X3W2_MANHA/3-129; Phage minor tail protein U  ali follow..  1.............SNEAIRQEVIDLLQGNIQGIQHFHNGIAVFIDEAEYSQLTLCDGECNAYLKIGIYLPMFSTENDLDLVAQKISDVM........ 89
10 -5.740PF02771.14; Q0C2Q3_HYPNA/14-126; Acyl-CoA dehydrogenase, N-terminal domain  ali follow..  19  17NEIAPRAAEIDRTDKFP--RDLLPKMGELGLLGITVEEEWGGTGLGYLEHVVAMEEISRASASVLRRWGNDQQKARYLPKLIS.............. 111

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.