current user: public




PF02641
Query: PF02641.10; Y448_AQUAE/1-95; Uncharacterized ACR, COG1993, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MKEVLMRIYSSKEENLEDYINKLFEGGIRGAVVLQGIAGFGKGREFHSEEIEVLSYELPVVIEVVEDREKLLNFLKENRETFKNCYITFERVKVWLast
1 -59.300PF02641.10; Y448_AQUAE/1-95; Uncharacterized ACR, COG1993  ali  100  1MKEVLMRIYSSKEENLEDYINKLFEGGIRGAVVLQGIAGFGKGREFHSEEIEVLSYELPVVIEVVEDREKLLNFLKENRETFKNCYITFERVKVW 95
2 -10.700PF11582.3; Q89MS9_BRAJA/2-103; Protein of unknown function (DUF3240 topsan)  ali follow..  18  3.EYVCLSLIL-ARKLREELLDFLQPGQTSGFTVSD-AAGHGSGVQLPTAAERVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNLVYWIAPV. 95
3 -8.990PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali follow..  23  4.........IIKPFKLDDVRESLSEIGVQGITVTE-VKGFGRQKELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKI........ 83
4 -7.020PF01613.13; Q4ZTS7_PSEU2/11-158; Flavin reductase like domain  ali follow..  12  6............................SGVTIVTTLDPEGNLVGITASAFSALSIDPALVLFCPNYESDTYPVLRDSRKFAIHLL......... 63
5 -6.270PF12537.3; B4IVC6_DROYA/125-195; Protein of unknown function (DUF3735 topsan)  ali follow..  13  6..................IEQGVSRISVIGVTVMAILWGFGAIKPVSRNDIICFERRLALTVDMLTAKKL......................... 68
6 -6.260PF12479.3; B5RU71_DEBHA/316-412; Protein of unknown function (DUF3698 topsan)  ali follow..  15  5.............................GITLRSAIAGFFYK---DNAEALSTKEKFAGLIEISQKTKGPDPLANVLPRLVEE........... 56
7 -6.080PF09391.5; A9CKI6_AGRT5/3-135; Protein of unknown function (DUF2000 topsan)  ali follow..  12  51LSIQPIVVMATDQEALRKIHQRSLERDITTSLYIEEMFATGHDAANRQVFSHFSPDTAKVVMALRADRKIVDKITKGAK................ 130
8 -6.000PF09167.6; A0QQP4_MYCS2/36-160; Domain of unknown function (DUF1942 topsan)  ali follow..  15  64.....LNARAANGENYRVLFQVATPQGVNPSTLAPGQKTTGK--------YFDVTGEAPTTVVYNDGERDL........................ 122
9 -5.950PF07489.6; Q47014_ECOLX/326-538; Translocated intimin receptor (Tir) C-terminus  ali follow..  22  4.NSQAQQKYDEQHAKREQEMSLSSGVGISGALILGGGIGAGVTAALHRKN............................................. 54
10 -5.800PF06544.7; Q5RIL0_DANRE/155-279; Protein of unknown function (DUF1115 topsan)  ali follow..  15  4................HHIYNKIKRKNILEWAKELNLSGFSMPGK-------------PGIVCVEGLQSVCDEFWARLKVL.............. 55

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Li Z, Szczurek E, Godzik A. Putative type IV secretion genes in Bacillus anthracis. Trends Microbiol. 2007 May;15(5):191-5. Epub 2007 Mar 26.