current user: public




PF00543
Query: PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II, from PfamA26U

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTGLast
1 -71.200PF00543.17; O54449_AZOVI/4-105; Nitrogen regulatory protein P-II  ali  100  1VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTG 102
2 -33.700PF06153.6; YAAQ_BACSU/1-109; Protein of unknown function (DUF970 topsan)  ali follow..  12  4IVAVVQDQDSNRLLKTLTDHNF-RVTKLATTGGFLKSGNTTFMIGVEDLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF... 109
3 -20.900PF11582.3; Q89MS9_BRAJA/2-103; Protein of unknown function (DUF3240 topsan)  ali follow..  14  7LSLILARKLREELLDFLSEQQTSGFTVSDAAGHGSGVQLPTA---AERVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNL---VYWIAPVAEFGTI... 101
4 -8.990PF02641.10; Y448_AQUAE/1-95; Uncharacterized ACR, COG1993  ali follow..  23  10...SSKEENLEDYINKLFEGGIRGAVVLQIAGFGKGR---EFHSEEIEVLSYELPVVIEVVEDREKLLNFLKENRETFKNCYI................... 87
5 -7.020PF03529.8; Q90XY9_SCYCA/57-141; Otx1 transcription factor  ali follow..  10  1.....SPASISPIAPDCLSTSSSPMNYTQASGYTQGYAGSTSYFGGMDCGSYLSPMHHQLPAPGTALSPMSSNAVTAGHLNQ.................... 83
6 -6.650PF03466.15; Q98I60_RHILO/88-294; LysR substrate binding domain  ali follow..  14  6.................................GVLRVTTTVGLGAGWLTERVPEISLQLILANEELDLTMRQADCAIRLRQPQQPDLIQRRLFTV...... 75
7 -6.640PF07858.7; Q8XW85_RALSO/2-128; Limonene-1,2-epoxide hydrolase catalytic domain  ali follow..  11  11CAAFVEDGGRPAVRRWFTP------TRWVNEGVSATTGVDEAIAMIDGLETSMGISTVHFDVIAIAADGSRVLTERVDRFERADGAEIGRVTLMGIFKVEGE 107
8 -6.160PF00924.13; YKUT_BACSU/67-262; Mechanosensitive ion channel  ali follow..  19  23...........DPSALLAGAGIVGLAV----GFGAQGLVSDIVTG--FFILLEKQLDVGDYITVSTFDGIVEQVGLRTTQIRSFDGTLHYIPNRNITNVSN. 106
9 -6.060PF10126.4; Y1110_METTH/1-151; Uncharacterized protein, homolog of nitrogen regulatory protein PII  ali follow..  17  48LRVFIEVENLGRVMNILADEGVTGFYIVEYKGVSPTEWKGSVKEDPESAISLIDAVLICSVVDEELVEPIVNRFGEELASEK.................... 135
10 -6.010PF00984.14; O31279_GLUXY/206-301; UDP-glucose/GDP-mannose dehydrogenase family, central domain  ali follow..  11  17....MKITFINEISDLCEKVGANVNDVARSIGLDGRIGKKFLHPSPGFGGSCFPKDTRALTAIGRNAGSPVRLIETTVAVNE.................... 94

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.