current user: public




Query: PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II, from PfamA30U

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTGLast
1 -72.400PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II  ali  100  1VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTG 102
2 -11.200PF11582.6; Q89MS9_BRADU/2-103; Protein of unknown function (DUF3240 topsan)  ali follow..  14  7LSLILARKLREELLDFLSEQQTSGFTVSDAAGHGSGVQLPTA---AERVKGHADQVHVQIVLPGADARRLVDQLRHSFAGCNL---VYWIAPVAEFGTI... 101
3 -9.690PF06153.9; YAAQ_BACSU/1-109; Cyclic-di-AMP receptor  ali follow..  12  4IVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGF--KSGNTTFMIGVE-LIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF... 109
4 -7.270PF10436.7; A8Q5Z3_MALGO/25-287; Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase  ali follow..  17  1.......................GVSLRQMVIFGRNANPGTLLLASSFLMEELP---VRFAHRVKDLQELPGNLSDMPSIIKV................... 57
5 -7.230PF16774.3; A8ATQ3_9CAUD/1-165; Baseplate protein  ali follow..  21  2...IPKKFKLINSRGDLNDHTETGLFVLNWDGLGVDIKFDTPRAIYNGLVTFLNYSPYTLTMEDENGMYNRDVQIQTMTLTDLKDGVVFEETIE........ 128
6 -6.870PF02641.13; G7V719_THELD/8-104; Uncharacterized ACR, COG1993  ali follow..  17  20..........EAIVNRAKELSMAGATVLRILGFGA---HSRLHSAKILRLSEDLPVVIEIVDTPERIQAFLPHLDEMITEGLVTLEKVQV............ 97
7 -6.510PF03466.18; Q98I60_RHILO/88-294; LysR substrate binding domain  ali follow..  13  1............................KDRPSGVLRVTTTVGLGAGWLTERVPEISLQLILANEELDLTMRQADCAIRLRQPQQPDLIQRRLFTV...... 75
8 -6.400PF00924.16; YBIO_ECOLI/514-715; Mechanosensitive ion channel  ali follow..  11  23...........NIAPLLAGAGALGLAI----SFGSQTLVKDIITGVFIQFE--NGMNTGDLVTIGPLTGTVERMSIRSVGVRQDTGAYHIIPWSSITTFAN. 106
9 -6.190PF10126.7; F4BUV1_METCG/1-107; Uncharacterized protein, homolog of nitrogen regulatory protein PII  ali follow..  18  5VKIFVDHEHLVRVINSLTELGITGFYLIEYQGMAPTNWKSQLSEDPDMALKAIPGVMVNTVVGPDKCQRLIKELEEALKGIR.................... 92
10 -6.010PF16785.3; Q2Y713_NITMU/1-110; Small metal-binding protein  ali follow..  13  25..........HHAAQAIEH-------AAMAKAHGEDGHAKVLLKHAEESLTHAQAAEKQHAEQHKHMTDSIKELKQAIEHAKAGHADVATKHVDEALM.... 105

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.