current user: public




Query: PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II, from PfamA30U

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTGLast
1 -71.5001ul3_A mol:protein length:112 Nitrogen regulatory protein P-II  ali model follow..  54  4VEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKIEIVVDEGQVDMVVDKLVSAARTGEIGDGKIFISPVDSVVRIRTG 105
2 -71.4004aff_A mol:protein length:116 NITROGEN REGULATORY PROTEIN P-II  ali model follow..  58  4IEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGENGDGKIFVSPVDQTIRIRTG 105
3 -71.4003n5b_A mol:protein length:112 Nitrogen regulatory protein P-II  ali model follow..  59  4VEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKVEIVVEDNQVDMVVDKIIAAARTGEIGDGKIFISPVEQVIRIRTG 105
4 -71.3001qy7_A mol:protein length:112 Nitrogen regulatory protein P-II  ali model follow..  60  4IEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGAEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTG 105
5 -71.3003mhy_A mol:protein length:112 PII-like protein Pz  ali model follow..  71  4VMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTG 105
6 -71.3001hwu_A mol:protein length:112 PII PROTEIN  ali model follow..  77  4VTAIIKPFKLDEVRESLAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEVVVDDKVVEQAVDAIIKAARTGKIGDGKIFVQEVEQVIRIRTG 105
7 -71.3001pil_A mol:protein length:112 SIGNAL TRANSDUCING PROTEIN P2  ali model follow..  68  4IDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTG 105
8 -71.1002gnk_A mol:protein length:112 PROTEIN (NITROGEN REGULATORY PROTEIN)  ali model follow..  77  4VTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGNAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTG 105
9 -71.1002eg1_A mol:protein length:112 Nitrogen regulatory protein P-II  ali model follow..  64  4IEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFGQQKGHTEIYRGTEYVIDFLPKVKIEVVVRDEDVEKVVETIVKTAQTGRVGDGKIFIIPVEDVIRIRTG 105
10 -70.7002gw8_A mol:protein length:114 PII signal transduction protein  ali model follow..  66  6IEAIVKPFKLDDVREALTEIGITGMTVSEVKGFGRQKGHTEIYRGAEYAVDFLPKIKIELVLADDAVERAIDVIVEVARSGKIGDGKIFVLPVEEAIRIRTG 107
11 -70.5003bzq_A mol:protein length:114 Nitrogen regulatory protein P-II  ali model follow..  59  6ITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAEYSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTG 107
12 -70.2003o8w_A mol:protein length:118 Nitrogen regulatory protein P-II (GlnB-1)  ali model follow..  50  4VVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGREVEVDLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTG 105
13 -70.0002ns1_B mol:protein length:116 Nitrogen regulatory protein P-II 2  ali model follow..  77  8VTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEFSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTG 109
14 -69.2001ufl_A mol:protein length:116 Nitrogen regulatory protein P-II  ali model follow..  39  4IVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTG 105
15 -69.1002j9c_A mol:protein length:119 HYPOTHETICAL NITROGEN REGULATORY PII-LIKE PRO  ali model follow..  50  6VEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVERYRGREYIVDLIPKVKIELVVKEEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRTK 107
16 -68.3003ncp_A mol:protein length:119 Nitrogen regulatory protein P-II (GlnB-2)  ali model follow..  43  4IEAIVRAEKFPEVKAALEERGFYGMTVTDVKGRGQQGGMQIQFRGRTMEVTLLPKVKLEIVVKDDAVEEVIGLIVNSAFTGSPGDGKIFIIPVEDVVRIRTG 105
17 -66.6003l7p_A mol:protein length:115 Putative nitrogen regulatory protein PII  ali model follow..  41  6IEAIIRSDKLEDLKAALVQSGIKGMTISQVLGFGNQRGYTEYVRGQKITPTLLAKVKVEIVAHDAAVEEMITTISQAVKTGEVGDGKIFVSPVDEIVRIRTG 108
18 -66.5004rx6_A mol:protein length:121 Nitrogen regulatory PII-like protein  ali model follow..  37  13VEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTG 114
19 -65.5002o66_A mol:protein length:135 PII protein  ali model follow..  45  16VEAIVRPWRIQQVSSALLKIGIRGVTVSDVRGFGAQGGSTERHGGSEFSEDFVAKVKMEIVVKKDQVESVINTIIEGARTGEIGDGKIFVLPVSDVIRVRTG 118
20 -65.4004r25_A mol:protein length:114 Nitrogen regulatory PII-like protein  ali model follow..  37  6VEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTG 107
21 -64.2004ozj_A mol:protein length:143 Nitrogen regulatory protein P-II  ali model follow..  47  29VMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSQPAKKSQWRGEEYTVDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTG 130
22 -62.0004ush_A mol:protein length:154 NITROGEN REGULATORY PROTEIN PII  ali model follow..  41  21IEAIFRPWRLPFVIDTLSKYGIRGLTNTPVKGVGVQGGSRERYAGTEFPSNLVDKEKLDIVVSRAQVDAVVRLVAASAYTGEIGDGKIFVHPVAEVVRIRTA 123
23 -29.0004wk1_A mol:protein length:129 PstA  ali model follow..  12  18IIAIVQDQDSQELADQLVKNNF-RATKLATTGGFLRAGNTTFLCGVNSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVDAFHQF... 123
24 -21.9002cz4_A mol:protein length:119 hypothetical protein TTHA0516  ali model follow..  13  22VTIVAESLLEKRLVEEVKRLGAKGYTITPARGEGSRGIRSVDWEGQ--------NIRLETIVSEEVALRILQRL--QEEYFPHYAVIAYVENVWVV...... 107
25 -20.6003dfe_A mol:protein length:111 Putative Pii-Like Signaling Protein  ali model follow..  19  9LVIVTEKVLLKKVAKIIEEAGATGYTVVDTGGKGSRNVRSTGKPN---TSDTDSNVKFEVLTENREMAEKIADQVAIKFFTDYA-GIIYICEAEVL...... 100
26 -18.3003ce8_A mol:protein length:120 Putative PII-like nitrogen regulatory protein  ali model follow..  17  20LVLIAQNDIKDDIVDTLIELFLSGFSLGNICGFSREHSHFNI---KEQVEGYREFCKFEIMHPAAQQAALLTALALVCKHNPC---RYWIMPIYQNGTL... 113
27 -17.8005D4L Entity 1(prereleased)  ali follow..  17  14LEIILEGAHKEFATDLLDRAGVKGYTIVGNLS----KGSHGMYEGHLMFNEDDALIMIIAAVPEELVGPLLEGFQPFFEA---HSGVVFVHDIQVG...... 103
28 -10.1003m05_A mol:protein length:114 uncharacterized protein PEPE_1480  ali model follow..  18  9VIAIVQDKDANYLSDQFIDQNVRATKLSTTGGF--QSGNTTFMIGIE-IIKKASHTREEFMTPSVNMDVNMEGTTAYPIKVQVGGATVLVLPVDQFERF... 114
29 -10.0004rwx_A mol:protein length:114 Lmo2692 protein  ali model follow..  14  4IFAIVQDQDSNRLSDALTKGNFGATKLATTGGF--KAGNTTFIIGTE-IIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHFLEH 112
30 -9.8404rle_A mol:protein length:117 Uncharacterized protein YaaQ  ali model follow..  12  6IVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGF--KSGNTTFMIGVE-LIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF... 111

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.