current user: public




Query: PF00543.20; C1DJ64_AZOVD/4-105; Nitrogen regulatory protein P-II, from PfamA30U

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst VTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIDVAIEDSQLDHVIEAITKAANTGKIGDGKIFVVNLEQAIRIRTGLast
1 -71.300[E] COG0347 Nitrogen regulatory protein PII  ali follow..  76  4IMAIIKPFKLDEVREALSQVGVSGITVTEVKGFGRQKGHTELYRGAEYIVDFLPKVKIEVAVPDDVLERAVEAIEKSARTGKIGDGKIFVTDVEQVIRIRTG 105
2 -9.750[S] COG3870 Uncharacterized protein conserved in bacteria  ali follow..  15  4IFAIVQDQDSNRLSDALTKGNFGATKLATTGGF--KAGNTTFIIGTE-IIKENCKAREQMMTPSASLGVTVDTYVPYPIEVQVGGATVFVMPVESFHHF... 109
3 -9.410[S] COG3323 Uncharacterized protein conserved in bacteria  ali follow..  18  10LAVYVPKEYEEQVRAALGNAGAGHICAFSSEGIGKPLDGAKPFIGEVGELELVHEVRLETVFPKSVEKAVINAMIKS......................... 93
4 -7.610[S] COG1993 Uncharacterized conserved protein  ali follow..  18  28..........EAIVNKAREMQMAGATVLRPLGFGH---SSILHTAKILRLSQDLPTVIEIVDAPEKIEHFIPQVMKMTQSCLI................... 98
5 -6.850[K] KOG4795 Protein associated with transcriptional elongation factor ELL  ali follow..  13  38....FKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPY----LKECILIINHDTGECRLEKLSSNITVKK.................... 111
6 -6.640[K] COG5450 Transcription regulator of the Arc/MetJ class  ali follow..  13  28.....QQIRLDELVTTTTVLALDRLLSEDSTFYGDLFPHAVKWRGTTYLEDGLHRAVRAALRNRTVLHARVFDMDASP........................ 100
7 -5.960[S] COG4075 Uncharacterized conserved protein, homolog of nitrogen regulatory protein PII  ali follow..  17  48LRVFIEVENLGRVMNILADEGVTGFYIVEYKGVSPTEWKGSVKEDPESAISLIHDVLICSVVDEELVEPIVNRFGEELASEK.................... 135
8 -5.840[C] KOG0761 Mitochondrial carrier protein CGI-69  ali follow..  14  234.VTAITPIEMVRIKMQSEYMTYAE-LWRVLRSLIRQHGILGLWRGPPTVMRDAPFSGTYWAVYEVTEPTFLFSFLTGAISGAVA--TFVTMPFD-LITTH.. 336
9 -5.450[T] KOG4458 Nitric oxide synthase-binding protein, contains PTB domain  ali follow..  26.........................................FQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKV... 83
10 -5.450[G] COG3925 N-terminal domain of the phosphotransferase system fructose-specific component IIB  ali follow..  11  12.....................................GQARAYMAKTLLGAAARKAKLEIIDNPNDAEMAIVLGDSIPNDSALNGKNVWLGDISRAVA.... 72

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.