current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN, from PDB0516

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# E-value Template Links and tools%idFirst GSEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTAALast
1 3.000e-38gi|1005441803|ref|XP_015758226.1| PREDICTED: EGF-like repeat and discoidin I-like domain-containing protein 3 [Acropora digitifera]  clstr ali  22  172...TDINECLSSPCQNGATCSDEVNKYSCACQVGYRGYNCQ-TDINECLSSPCQNGATCSDEVNKYSCTCQVGYIGYNCQT.... 248
2 3.000e-37gi|919062301|ref|XP_013412803.1| PREDICTED: uncharacterized protein LOC106175385 [Lingula anatina]  clstr ali  18  163.CEIDINECDSYPCQNGGTCRDSVNDYSCTCHPGFKGKSCE-INIDECDSAPCQNGGKCQDDINGYSCMCPGGFQGKNCEI.... 241
3 3.000e-36gi|762113748|ref|XP_011439637.1| PREDICTED: latrophilin-3-like [Crassostrea gigas]  clstr ali  17  9...RDIDDCLTDPCQNNGTCTDLVNDYQCDCMVGFNGTNCEN-NINDCIPEPCQNNGTCIDLINDYQCDCTHGFNGTTCTNNID. 88
4 4.000e-35gi|405960948|gb|EKC26815.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Crassostrea gigas]  clstr ali  21  307.CEIDIDECQSSPCING-NCTNNINFYTCQCFAGFTGTNCE-IDIDECASSPCVHG-NCTDQVNGYVCECIPGYTGVICETD... 384
5 6.000e-35gi|919011482|ref|XP_013390182.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Lingula anatina]  clstr ali  18  246....DIDECASQPCKNGATCKDGVNSYSCVCLSGYTGQTC-AIEIDECASQPCKNGATCMDGVNFYSCVCLSGYTGQTC...... 319
6 3.000e-34gi|444730184|gb|ELW70574.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Tupaia chinensis]  clstr ali  19 1362.CETDINECQPSPCLNNAICEDQVGGFLCKCPAGFLGTRCE-INIDECLSQPCKNGAACKDGPNSFRCQCVAGFSGSYCELDI.. 1442
7 4.000e-34gi|405966781|gb|EKC32021.1| Fibropellin-3, partial [Crassostrea gigas]  clstr ali  20  73.CENNIDECYHILCQNNGTCRDQVNAYQCNCVPGFNGTHCEN-NIDECSSGPCQNYGTCTDLLNDYNCSCVPGFNGTNCENN... 152
8 7.000e-33gi|351712034|gb|EHB14953.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Heterocephalus glaber]  clstr ali  21 1175.CEENINECSSSPCLNKGTCVDDVAGYHCTCVKGYIGLHCE-TEVDECQWNPCLNNAACEDQVGRFLCKCPPGFFGIRCEMNID. 1256
9 2.000e-31gi|565315138|gb|ETE67092.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Ophiophagus hannah]  clstr ali  22  475.CEKEIDECKSSPCLNKGICKDGTAAFICQCQPGYSGTHCE-TEVNECLSNPCFNKATCEDQVAGFHCKCLPGFIGALCEKNI.. 555
10 3.000e-31gi|919011480|ref|XP_013390181.1| PREDICTED: fibropellin-1-like [Lingula anatina]  clstr ali  20  237...TDIDECASQPCKNRTTCKDGLNSYSCVCPPGYTGQTC-GIDIDECATRPCKNRTTCKDGVNSYSCVCPPGYTGQTC...... 311
11 2.000e-30gi|1009579576|ref|XP_015921247.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Parasteatoda te  clstr ali  20 1383.CEINIDDCADSPCKNNATCVDDVMIFKCECLAGFEGIFCE-TNVNECQPQPCMNGGTCIDRIAGFKCLCPPSYVGDLCETE... 1462
12 2.000e-30gi|591384083|ref|XP_007066499.1| PREDICTED: versican core protein [Chelonia mydas]  clstr ali  23  351......DPCKSNPCLHGGTCYPRGSYYICTCMPGFSGEQCE-LDVDECQSNPCRNGATCIDGLNLFTCLCLPSYVGALCEQDTE. 427
13 2.000e-29gi|675364517|gb|KFM57419.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Stegodyphus mimosarum]  clstr ali  18  904.CEINIDDCASSPCKNEAICIDDIMFFKCECLAGFEGTYCE-IDINECQLQPCMNGATCMDMIAGFKCLCPPSYVGDLCETE... 983
14 1.000e-28gi|919021103|ref|XP_013394438.1| PREDICTED: extracellular matrix protein A-like [Lingula anatina]  clstr ali  23  628.CEIDVNECASNPCENAGNCIDKPGHYNCSCSAGFMGANCE-TDIDECASNPCENAGTCMNTDGHYNCSCSTGFTGDNCEIDI.. 708
15 2.000e-28gi|919002970|ref|XP_013415168.1| PREDICTED: fibropellin-3-like [Lingula anatina]  clstr ali  16  97.CEIDINECSSSPCLNGGTCKDEVNKFTCVCLPGYAGRRCE-IDIDECYWTQCENNGTCTDFINGYQCHCIPYTTGRHCQ..... 174
16 2.000e-28gi|780151301|ref|XP_011681813.1| PREDICTED: uncharacterized protein LOC100889023 [Strongylocentrotus purpuratus]  clstr ali  24  48........CLARPCWNGAICDETVDGFSCTCAEGFSGPLCEE-DINECLSHPCENGAVCQDGIDRYICECMSGYEGTHCETET.. 121
17 6.000e-28gi|694913847|ref|XP_009448507.1| PREDICTED: coagulation factor XII isoform X1 [Pan troglodytes]  clstr ali  97  133..EKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGRFCDVDTKA 215
18 2.000e-27gi|919091716|ref|XP_013382784.1| PREDICTED: delta and Notch-like epidermal growth factor-related receptor [Lingula anatina]  clstr ali  20  503....EINECDSSPCDNNGTCIDDAANFTCMCVDGYEGITCAH-DINECERAPCDNGATCIEGVNNYTCLCSLGYEGRNCSNDID. 582
19 3.000e-27gi|675688560|ref|XP_008956576.1| PREDICTED: coagulation factor XII [Pan paniscus]  clstr ali  98  133..EKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTKA 215
20 4.000e-27gi|919038830|ref|XP_013402904.1| PREDICTED: integrin beta-like protein A [Lingula anatina]  clstr ali  16  552.CETDVDECLSNPCVNSGTCNNLLNGFNCTCPVGFIGDMCE-TDIDECDDSPCQNNATCENLAGNFSCTCLEDFNGTRCENE... 631
21 4.000e-27gi|260835699|ref|XP_002612845.1| hypothetical protein BRAFLDRAFT_118409 [Branchiostoma floridae]  clstr ali  19 1886......DPCKNAECQNDATCEPDGESFKCICPKGYAGTMCE-TNVDDCAANPCQNDGTCQDGVDGFTCICPKGFAGNLCETNVD. 1962
22 4.000e-27gi|1020488437|ref|XP_016149914.1| PREDICTED: versican core protein-like [Sinocyclocheilus grahami]  clstr ali  25 1360........CSVSVCENGGTCYSNGKGNKCFCMPGYSGEHCEN-DVDECQSNPCRNGGTCIDGLNSFSCVCLPSYSGPLCEQDTE. 1434
23 6.000e-27gi|585650438|ref|XP_006814579.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Saccoglossus kow  clstr ali  22  806.CEIDIDECLTNSCYNNATCMDKVNGFSCHCMQGYSGILC-DIDINECLSAPCSSTSTCLDLVGSYQCICPPAYSGVHCDIE... 885
24 6.000e-27gi|831247945|ref|XP_012668853.1| PREDICTED: coagulation factor XII isoform X1 [Otolemur garnettii]  clstr ali  77  136..EKCFEPQLLRFFRENETWYRSQLGGVAKCQCKGPDNRCQQLASQACLTNPCLNGGRCLEAEGHHLCHCPMGYTGPFCDIDTEA 218
25 8.000e-27gi|780059913|ref|XP_011670265.1| PREDICTED: protein eyes shut-like [Strongylocentrotus purpuratus]  clstr ali  27  2.....................DFVNGYTCSCLDGFIGTHCEF-DINECSSNPCMNGGNCMDLVDGYTCSCPDGFIGTHCEFDI.. 62
26 9.000e-27gi|405977490|gb|EKC41937.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  15  84....NIDECAVLPCQNNGTCRDLINDYQCFCIDGFNGEKC-TNNIDDCLPDPCENNGTCTDLVNDYQWNCMLGFNGTNCENNID. 162
27 1.000e-26gi|685549061|ref|XP_009207907.1| PREDICTED: coagulation factor XII isoform X1 [Papio anubis]  clstr ali  93  133..EKCFEPQLLRFFHENEIWYRSEQAAVARCQCKGPDAHCQQLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDLDTKA 215
28 1.000e-26gi|884925050|ref|XP_013011708.1| PREDICTED: coagulation factor XII [Cavia porcellus]  clstr ali  75  134..EKCFEPQLHRFFHENEIWFRTGPAGVAKCHCKGPDAHCKQMHSQECQTNPCLNGGRCLEVEGHHLCDCPMGYTGPFCDLDTTA 216
29 2.000e-26gi|731211521|ref|XP_010620361.1| PREDICTED: coagulation factor XII isoform X4 [Fukomys damarensis]  clstr ali  80  134..EKCFEPQLLRFFHENEIWLKTGPAGVAKCHCKGPDAHCKPMASQACRTNPCLNGGHCLEVEGHRLCHCPMGYTGPFCDLDTEA 216
30 3.000e-26gi|947297786|ref|XP_014447258.1| PREDICTED: coagulation factor XII [Tupaia chinensis]  clstr ali  79  133..EKCFEPQLLRFFHEDEIWHRAEPGGVARCQCRGPDAHCRRLASQACSTNPCLNGGRCIAAQGQRLCHCPAGYTGPFCDVDT.. 213
31 3.000e-26gi|731211517|ref|XP_010620359.1| PREDICTED: coagulation factor XII isoform X2 [Fukomys damarensis]  clstr ali  80  134..EKCFEPQLLRFFHENEIWLKTGPAGVAKCHCKGPDAHCKPMASQACRTNPCLNGGHCLEVEGHRLCHCPMGYTGPFCDLDTEA 216
32 3.000e-26gi|1007711284|ref|XP_015829417.1| PREDICTED: versican core protein-like [Nothobranchius furzeri]  clstr ali  27 1064.......PCSISVCQNGGSCYRTGSQSICICAPGYTGPQCE-TDVDECHSNPCLNGATCQDGVNSFTCLCLPSYSGKLCEQDTA. 1139
33 4.000e-26gi|992179461|ref|XP_007234607.2| PREDICTED: serine-rich adhesin for platelets-like [Astyanax mexicanus]  clstr ali  25 4818.......SCTSDSCLNGGSCVTMGNTQTCSCLPGFSGEHCE-IDIDECHDNPCLNGGTCVDGVNSFSCVCLPSYTGALCEQDTE. 4893
34 5.000e-26gi|528758211|gb|EPY77870.1| hypothetical protein CB1_001165003 [Camelus ferus]  clstr ali  71  96..EKCFESQLLRFFQENEIWHRLERAGVAKCQCKGPNAHCKPVASQVCRTNPCLNGGSCLQAEGHRLCRCPAGYAGRLCDVDLKA 178
35 6.000e-26gi|736178327|ref|XP_010767903.1| PREDICTED: versican core protein-like isoform X1 [Notothenia coriiceps]  clstr ali  20 2638......DSCTENICLNGGSCFKSGSIYTCSCTPGYGGYRCE-TDIDECQSNPCRNGGTCFDRLAYFTCVCLPSYSGLYCEEDTE. 2714
36 7.000e-26gi|260792245|ref|XP_002591126.1| hypothetical protein BRAFLDRAFT_105530 [Branchiostoma floridae]  clstr ali  18  394......DKCSN--CVNGATCKGCFNSLTCDCQAGFTGERCE-ININECASNPCQNNGLCVDGANSYGCQCTRGFSGANCEIEID. 470
37 7.000e-26gi|1007790655|ref|XP_015831572.1| PREDICTED: versican core protein-like [Nothobranchius furzeri]  clstr ali  25 1057.......SCTMNVCLNGGSCYKTGSAYSCSCAPGYTGHQCE-TEIDECQSNPCRNGGTCVDGVMSFTCVCLPSYSGLHCEEDTE. 1132
38 7.000e-26gi|634882037|ref|XP_007951146.1| PREDICTED: coagulation factor XII [Orycteropus afer afer]  clstr ali  69  133..EKCFEPQLLRFFHEDEMWHRLGPAGVDKCQCKGPNVHCKPLASGACSRNPCLNGGRCLEAEGRTLCHCPAGYAGPICDVDTEA 215
39 7.000e-26gi|821114300|ref|XP_004460084.2| PREDICTED: coagulation factor XII isoform X1 [Dasypus novemcinctus]  clstr ali  77  129..EKCFEPQLLRFFHENALWYRLQPAGVAKCQCKGPNAHCKLLASQDCLTNPCLHGGRCLEAEGQRLCSCPAGYAGPFCDVDTEA 211
40 8.000e-26gi|908559250|ref|XP_005466557.2| PREDICTED: versican core protein-like [Oreochromis niloticus]  clstr ali  21  826.....IDSCTEDVCLNGGSCLTIGSTYTCHCAPGFSGHQCE-IDIDECESNPCRNGGTCVDGLASFTCVCLPSYAGLFCEEDTE. 903
41 1.000e-25gi|260826470|ref|XP_002608188.1| hypothetical protein BRAFLDRAFT_125860 [Branchiostoma floridae]  clstr ali  16  329.CETDIDECASDPCQYGGTCTDGVNGYTCECVAGYTGDDCE-TDTNECEGVTCDNGGTCVDGINEYSCDCADGFFGDHCET.... 407
42 1.000e-25gi|260789858|ref|XP_002589961.1| hypothetical protein BRAFLDRAFT_81597 [Branchiostoma floridae]  clstr ali  18  256......DKCSN--CVNGATCKGCFNSLTCDCQAGFTGERCE-ININECASNPCQNNGLCVDGANSYGCQCTRGFSGANCEIEID. 332
43 1.000e-25gi|444706646|gb|ELW47972.1| Coagulation factor XII [Tupaia chinensis]  clstr ali  79  133..EKCFEPQLLRFFHEDEIWHRAEPGGVARCQCRGPDAHCRRLASQACSTNPCLNGGRCIAAQGQRLCHCPAGYTGPFCDVDT.. 213
44 2.000e-25gi|585653730|ref|XP_006884460.1| PREDICTED: coagulation factor XII [Elephantulus edwardii]  clstr ali  67  136..EKCFEPQLLRFFHEDETWYKLGPEGVYKCHCKGPQGHCKPLTSQACRTDPCLNGGRCLQAEGRSLCHCPEGYAGPICDVDTKA 218
45 3.000e-25gi|307192393|gb|EFN75628.1| Neurogenic locus protein delta [Harpegnathos saltator]  clstr ali  23  167.CEINVDDCQGDPCLNGGTCVDLVNSFRCQCVPGYVGRLCQDVDVDECRSAPCQNGGTCRNRVNGFLCDCPDGWYGDTC...... 281
46 3.000e-25gi|431892725|gb|ELK03158.1| Coagulation factor XII [Pteropus alecto]  clstr ali  65  45..EKCFEPQLFQFFHENETWLKLKPAGVAKCQCQGPQAHCKPLASQVCPTNPCLNQGRCLEVDGHQLCSCLEGYAGRNCDVDIKA 127
47 3.000e-25gi|507621727|ref|XP_004696880.1| PREDICTED: coagulation factor XII [Echinops telfairi]  clstr ali  72  138..EKCFEPQLLRFFHEDEKWYRFGPTGVDKCWCKGPDAHCKPLASQACHTNPCLNGGRCWEAEGHTLCRCPEGYAGPLCDVDTRA 220
48 3.000e-25gi|471361279|ref|XP_004371205.1| PREDICTED: coagulation factor XII [Trichechus manatus latirostris]  clstr ali  68  133..EKCFEPQLLRFFHEDEMWHRLGPAGVDKCHCKGPNFHCKPLPSQACRINPCLNGGRCLEAEGGTLCRCPAGYAGPTCDVDTEA 215
49 4.000e-25gi|919101201|ref|XP_013386954.1| PREDICTED: delta-like protein D [Lingula anatina]  clstr ali  19  193......NECAVNHCKNGGTC-----SYHCTCPVGYTGTLCE-VSIDDCASRPCLNGGTCYDNVNSYTCQCPRGFKGTNCEINID. 271
50 4.000e-25gi|537209834|gb|ERE80471.1| coagulation factor XII-like protein [Cricetulus griseus]  clstr ali  66  96..EKCFEPQLLQFFHENEMWFRTGPEGVARCQCKPPEAHCKPLAIQACSADICFNGGSCFQVEGHQLCHCPAGYTGPYCNLDTKA 178
51 4.000e-25gi|829879042|ref|XP_012642733.1| PREDICTED: coagulation factor XII [Microcebus murinus]  clstr ali  71  143..EKCFEPQLLQFFHEDEMWYRVEPPGVAKCRCRGPDAHCKPVASRACRANPCLNRGRCLEAEGLRLCQCPEGYAGPFCDVDTEA 225
52 4.000e-25gi|914917934|ref|XP_013217342.1| PREDICTED: coagulation factor XII [Ictidomys tridecemlineatus]  clstr ali  74  133..EKCFEPQLLRFFHENEIWLRSGPEGVAKCHCKGPDAHCKPLASHACHTNLCLNGGRCLEAEGQSLCHCPVGYTGPFCDLDVEA 215
53 4.000e-25gi|734644377|ref|XP_010751224.1| PREDICTED: aggrecan core protein-like [Larimichthys crocea]  clstr ali  26 1366.......PCSAAVCLNGGSCYRNGAQNICLCTPGYTGQHCE-TDVDECQSNPCLNGATCVDGVNSFTCLCLPSYAGELCEQDTE. 1441
54 6.000e-25gi|560898740|ref|XP_006175813.1| PREDICTED: coagulation factor XII [Camelus ferus]  clstr ali  71  133..EKCFESQLLRFFQENEIWHRLERAGVAKCQCKGPNAHCKPVASQVCRTNPCLNGGSCLQAEGHRLCRCPAGYAGRLCDVDLKA 215
55 1.000e-24gi|1008751219|ref|XP_015851189.1| PREDICTED: coagulation factor XII isoform X3 [Peromyscus maniculatus bairdii]  clstr ali  68  135..EKCFEPQLLRFFHEDEVWFRAGSEGLARCQCKGSGPHCKPLASQACSTNLCLNGGSCHQVEGHQLCHCPEGYTGPFCDLDIKA 217
56 2.000e-24gi|586486061|ref|XP_006873517.1| PREDICTED: coagulation factor XII [Chrysochloris asiatica]  clstr ali  68  133..EKCFEPQLQRFFDENEKWHRLGPAGVHKCQCKGPHAHCKPLAIQACRTNRCLNGGSCLEAEGRALCLCPTGYSGPICDVDTEA 215
57 3.000e-24gi|586489842|ref|XP_006875389.1| PREDICTED: hepatocyte growth factor activator [Chrysochloris asiatica]  clstr ali  36  362.QKKCFDRTRYEYLETGDHWARVHQGHVEQCSCAGGEAQCQDTRHTACLSNPCLNGGTCIVATGTTICACLPGYAGRLCNIVPA. 446
58 3.000e-24gi|965822395|ref|XP_011982212.2| PREDICTED: hepatocyte growth factor activator isoform X2 [Ovis aries musimon]  clstr ali  34  263GTAKCFDESRYEYLEPGDRWAHVHQGRVEQCECSGGQVHCEGTRHTACLSSPCLNGGSCIVATGTTVCACPPGYAGRLCNIVPA. 348
59 3.000e-24gi|742079697|ref|XP_010846427.1| PREDICTED: hepatocyte growth factor activator [Bison bison bison]  clstr ali  33  236.THKCFDESRYEYLEPGERWARVHQGRVEQCECAGGQIRCEGTRHTACLSSPCLNGGSCIVATGTTVCACPPDYAGRLCNIVPA. 320
60 5.000e-24gi|953848941|ref|XP_014594058.1| PREDICTED: LOW QUALITY PROTEIN: hepatocyte growth factor activator [Equus caballus]  clstr ali  34  207GTEKCFDETRYEHLEEGDRWARVHQGRVEWCQCAGGHVQCEGTRHTACLSNPCLNGGTCIVATGTSVCACPPDHAGRLCNIVPT. 292
61 5.000e-24gi|768920066|ref|XP_011603157.1| PREDICTED: versican core protein-like [Takifugu rubripes]  clstr ali  30 1061.......PCSTSVCQNGGSCYNNGLQDVCRCAPGYTGQHCE-TEVDECQPNPCLNGATCLDGPVSFTCVCLPSYTGELCEKDTE. 1136
62 5.000e-24gi|465980338|gb|EMP35559.1| Hepatocyte growth factor activator, partial [Chelonia mydas]  clstr ali  30  64...KCFDDSRYEYFDTGESWARIHKGIVEECMCVNSRIECQNTRYTSCTNNPCLHDSACIVFTGKTICGCKENFVGKYCNI.... 143
63 6.000e-24gi|821422826|ref|XP_012394087.1| PREDICTED: LOW QUALITY PROTEIN: coagulation factor XII [Orcinus orca]  clstr ali  67  178..EKCFEPQLLWFFQENEIWHRLELAGVAKCQCNGPNAQCKPLASQVCRTNPCLNGGSCLQADGHRLCSCPTGYAGRLCEVDHKA 260
64 8.000e-24gi|999978439|gb|KXJ17613.1| Fibropellin-1 [Exaiptasia pallida]  clstr ali  20  774.CEIDIDECQSSPCKNNSTCTDHVNNYTCTCVRGFTGRHCETGNLP-CSSSPCMNSGMCFNLPDSFWCRCRYGYGGDQCEI.... 853
65 9.000e-24gi|880928548|ref|XP_012974717.1| PREDICTED: coagulation factor XII [Mesocricetus auratus]  clstr ali  67  190..EKCFEPQLLRFFLENEMWFRTGPAGVTRCQCKTPGAHCKPLTSQACSSNMCLNGGSCHQVEGHQLCHCPAGYTGPYCNLDIKA 272
66 1.000e-23gi|507562685|ref|XP_004665030.1| PREDICTED: coagulation factor XII [Jaculus jaculus]  clstr ali  68  133..EKCFEPQLLRFFNEDDVWLRAEPTGIARCQCKGPNSQCKTLASQVCSTNRCLNGGRCLQAEGHSLCHCPEGYTGPFCDLDTKA 215
67 2.000e-23gi|837810458|ref|XP_012783125.1| PREDICTED: coagulation factor XII [Ochotona princeps]  clstr ali  71  134..EKCFEPQLLRTFHENDVWHRFEAGGVARCRCKGPDAHCKLLASQVCPTNPCLNQGRCLMAEGHRLCQCPPPYKGPFCDLDTEA 216
68 2.000e-23gi|1012205300|ref|XP_016013809.1| PREDICTED: coagulation factor XII isoform X2 [Rousettus aegyptiacus]  clstr ali  61  21..EKCFEPQLFQFFHENETWHKLKAADVVKCQCQGSQAHCKLLASRVCPTNPCLNQGRCLEADGHQLCHCPEGFAGRNCDVDIKA 103
69 2.000e-23gi|594036626|ref|XP_006042967.1| PREDICTED: coagulation factor XII isoform X2 [Bubalus bubalis]  clstr ali  67  21..EKCFEPQFFRFFHENEIWHRLEPAGVVKCQCKGPNAQCKPLASQVCRTNPCLNGGSCLQAEGHRLCRCPPSFAGRLCDVDLKA 103
70 2.000e-23gi|505835448|ref|XP_004611572.1| PREDICTED: coagulation factor XII [Sorex araneus]  clstr ali  73  133..EKCFEPQLLRFFHENEIWYRAEQAGGAKCQCRGPRAQCQVLTGQACQTSPCLNGGRCVEVEGHQLCHCPEGYSGSICDVDIGA 215
71 2.000e-23gi|674046308|ref|XP_008829176.1| PREDICTED: coagulation factor XII [Nannospalax galili]  clstr ali  73  207..EKCFEPQLLRFFHENEMWFRTGPTGVVKCQCKGPRAHCKPLASQACHTNLCLNGGSCLEVEGHQLCHCPEGHTGPFCDLDYKA 289
72 2.000e-23gi|537209835|gb|ERE80472.1| coagulation factor XII-like protein [Cricetulus griseus]  clstr ali  66  142..EKCFEPQLLQFFHENEMWFRTGPEGVARCQCKPPEAHCKPLAIQACSADICFNGGSCFQVEGHQLCHCPAGYTGPYCNLDTKA 224
73 2.000e-23gi|667287240|ref|XP_008576423.1| PREDICTED: coagulation factor XII [Galeopterus variegatus]  clstr ali  68  131..EKCHEPQLLQFFHENEIWHRTGPTDVMQCQCKSPGVLCKLLASQACSTNLCLNGGRCLEAEGHRQCHCPKGYIGPFCEVDIEA 213
74 2.000e-23gi|62078741|ref|NP_001014028.1| coagulation factor XII precursor [Rattus norvegicus]  clstr ali  71  132..EKCFESQLLKFFHENEIWFRTGPGGVARCQCKGPQAVCKLLTSQVCRVNPCLNGGTCLLVEDHRLCHCPAGYAGPFCDLDLKA 214
75 3.000e-23gi|731455871|ref|XP_010592582.1| PREDICTED: coagulation factor XII [Loxodonta africana]  clstr ali  69  132.SEKCFEPQLLRFFHKDEMWHRFGPRGVDKCQCKGPDVRCKPLASQACRTNPCLNGGRCLQAEGLTLCLCPAGYAGLICDVDIEA 215
76 3.000e-23gi|586537111|ref|XP_006923410.1| PREDICTED: coagulation factor XII [Pteropus alecto]  clstr ali  65  139..EKCFEPQLFQFFHENETWLKLKPAGVAKCQCQGPQAHCKPLASQVCPTNPCLNQGRCLEVDGHQLCSCLEGYAGRNCDVDIKA 221
77 4.000e-23gi|1012205296|ref|XP_016013808.1| PREDICTED: coagulation factor XII isoform X1 [Rousettus aegyptiacus]  clstr ali  61  138..EKCFEPQLFQFFHENETWHKLKAADVVKCQCQGSQAHCKLLASRVCPTNPCLNQGRCLEADGHQLCHCPEGFAGRNCDVDIKA 220
78 5.000e-23gi|852748060|ref|XP_012871444.1| PREDICTED: coagulation factor XII [Dipodomys ordii]  clstr ali  66  138..EKCFEPQLLRSFHEHETWLRAEPTGVARCQCKGPEAHCRSLASQACSRDLCLNGGHCLEAEGHPLCRCPAGYSGTFCELDMEA 220
79 5.000e-23gi|1020482122|ref|XP_016146556.1| PREDICTED: neurocan core protein-like [Sinocyclocheilus grahami]  clstr ali  23  891......DPCLTNPCLHGGSCLTEGEGYSCLCPQGYSGESCE-IDIDDCQSNPCQNGGTCIDEINSFVCLCLPSYGGATCEKDTE. 967
80 7.000e-23gi|919001954|ref|XP_013409852.1| PREDICTED: fibropellin-1-like [Lingula anatina]  clstr ali  21  352.......ECITSPCQNNGTCRDTAKGYACTCSSGFTGKDCE-TNIHDCQSAPCKNGAKCTDRVNGFSCDCASGFTGETCGVNI.. 427
81 7.000e-23gi|625291279|ref|XP_007637389.1| PREDICTED: coagulation factor XII isoform X2 [Cricetulus griseus]  clstr ali  66  133..EKCFEPQLLQFFHENEMWFRTGPEGVARCQCKPPEAHCKPLAIQACSADICFNGGSCFQVEGHQLCHCPAGYTGPYCNLDTKA 215
82 8.000e-23gi|640783890|ref|XP_008047630.1| PREDICTED: coagulation factor XII, partial [Tarsius syrichta]  clstr ali  78  133..EKCFERQVLQFFDQNEIWYRSEPAGVVRCQCRGPDSHCKLLASQACRTNPCLNGGRCLEAEGHRLCHCPAGYTGRFCDVDTEA 215
83 1.000e-22gi|999971770|gb|KXJ10944.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Exaiptasia pallida]  clstr ali  22  28........CHENSCHNGGTCKLDCAGVRCICPSGYQGQKCED-DINECSSNPCQNGGSCSDQVNGYNCTCVTGYTGANCQTNID. 104
84 1.000e-22gi|742088447|ref|XP_010886411.1| PREDICTED: neurocan core protein [Esox lucius]  clstr ali  25  844......EPCLTNPCLHGGKCLPQGQGYSCYCPQGFTGENCE-IDVDDCQSNPCLNGGTCIDKIDSFICLCLPSYSGHSCEKDVE. 920
85 1.000e-22gi|625188008|ref|XP_007621827.1| PREDICTED: coagulation factor XII isoform X1 [Cricetulus griseus]  clstr ali  66  133..EKCFEPQLLQFFHENEMWFRTGPEGVARCQCKPPEAHCKPLAIQACSADICFNGGSCFQVEGHQLCHCPAGYTGPYCNLDTKA 215
86 2.000e-22gi|1005440728|ref|XP_015757704.1| PREDICTED: uncharacterized protein LOC107337099 [Acropora digitifera]  clstr ali  21 1316........CPTTPCKNGATCVDDVVGRRCECKSGFTGSNCE-TDFRNCSTKPCKNGGTCVDHANGHRCYCRLGFTGSECETDI.. 1389
87 2.000e-22gi|999971759|gb|KXJ10933.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Exaiptasia pallida]  clstr ali  21  116........CQDNTCLNGGTCTNCTNWQTCICKMGFVGNKCE-VDLDECSSNPCKNGGSCSDQINGYNCTCVAGYNGTNCENDID. 192
88 3.000e-22gi|821456017|ref|XP_012408189.1| PREDICTED: coagulation factor XII [Sarcophilus harrisii]  clstr ali  60  126..EKCYEPQLRQFFDENETWLRAEPQRVAKCWCKGPTADCKWLNSQVCLDNPCLHGGKCLEAEGQSVCHCPPSYAGHFCEIDTSA 209
89 4.000e-22gi|655663630|ref|XP_008253687.1| PREDICTED: coagulation factor XII isoform X1 [Oryctolagus cuniculus]  clstr ali  71  133..EKCFEPQLHRFFHENDMWYRFERAGVAKCRCKGPDAHCKLLASQACPTNKCLNQGSCLVAEGHHLCHCRPPYTGPFCDLDTQA 215
90 1.000e-21gi|762114863|ref|XP_011440226.1| PREDICTED: cartilage matrix protein-like [Crassostrea gigas]  clstr ali  31  2....................................GIHCE-TEINECDSNPCQNGAQCADYVNRYSCTCVPGYMGTNCEIDID. 48
91 1.000e-21gi|762121051|ref|XP_011443441.1| PREDICTED: integrin beta-like protein A [Crassostrea gigas]  clstr ali  13  456.CEVDINECASNPCENQATCNDLVNFFNCTCLPGFTGDRCQ-IDINECEPGPCIFLFDCEDRINEYHCN................ 522
92 1.000e-21gi|780022702|ref|XP_011665360.1| PREDICTED: fibropellin-1-like [Strongylocentrotus purpuratus]  clstr ali  17  561.....FDECESSPCLFGSTCLDMINYYQCDCTDGYNGTNCEF-EIDECFSNTCQNDATCYDVINGYTCSCTSGYDGIHCENEID. 638
93 2.000e-21gi|919052997|ref|XP_013408403.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Lingula anatina]  clstr ali  34  130..............................CDPGYTGADC-ATNINECASNPCNNGGTCQDNINFYTCQCPPGYTGVNCETNI.. 181
94 2.000e-21gi|583979016|ref|XP_006784843.1| PREDICTED: versican core protein-like [Neolamprologus brichardi]  clstr ali  25  335....CFDSCTEDVCLNGGSCLRIGSTYTCHCAPGFSGHQCE-IDIDECESNPCRNGGTCVDGLASFTCVCLPSYAGLFCEEDTE. 416
95 3.000e-21gi|992200944|ref|XP_007246050.2| PREDICTED: delta-like protein 3 [Astyanax mexicanus]  clstr ali  22  347........CAERPCFNGGTCIDTTGGYSCRCPPGYMGSNCEK-KIDRCSSNPCANGGICRDQGLSFVCQCRPGFRGSRCEINID. 423
96 5.000e-21gi|528480304|ref|XP_002662132.3| PREDICTED: versican core protein [Danio rerio]  clstr ali  27  510....CFQSCSDAVCLNGGTCIKTGGAQICICQPGYSGEQCE-IDIDECHTNPCRNGGTCIDGLNSFTCLCLPSYAGALCEQDTE. 591
97 5.000e-21gi|664770995|ref|XP_008504666.1| PREDICTED: LOW QUALITY PROTEIN: coagulation factor XII [Equus przewalskii]  clstr ali  80  133..EKCFEPQLLQFFHENEIWYRLGPAGVAKCQCKGPDGHCKPLASQVCRTNPCLNGGRCLEAEGXXXXXXXX--XXXFCDVDTEA 213
98 8.000e-21gi|611975090|ref|XP_007474213.1| PREDICTED: coagulation factor XII [Monodelphis domestica]  clstr ali  60  127..EKCYQPQLRQFFNENETWLRAEPPRVAKCQCKGPSADCKWLNSQGCLDNPCLHGGMCLEAEGQSVCHCPPNYVGHFCEIDTSA 210
99 2.000e-20gi|593712820|ref|XP_007102941.1| PREDICTED: LOW QUALITY PROTEIN: coagulation factor XII [Physeter catodon]  clstr ali  67  133..EKCFEPQLLRFFQENEIWHRLELAGVAKCQCKGPNAQCKPQASQVCRTNPCLNAGSCLQAEGHRLCRSPHGYAGRLCEVDLKA 216
100 2.000e-20gi|831518932|ref|XP_012716750.1| PREDICTED: versican core protein [Fundulus heteroclitus]  clstr ali  21  357.......SCENNTCLNGGSCFKRGSIYSCNCSPGYTGQQCE-TDIDECQSNPCHNGGTCVDSLNSFTCVCLPSYSGLYCEEDTE. 432
101 2.000e-20gi|1016650713|ref|XP_016044161.1| PREDICTED: coagulation factor XII [Erinaceus europaeus]  clstr ali  63  137..EKCFEPQLLQFFGENDVWQRLEPAGVAKCQCKGPDVHCQLLPSKDCSTNRCLNGGHCLEAEGQ-LCRCPDGFGGHLCDIDLRA 218
102 2.000e-20gi|941808007|ref|XP_014328974.1| PREDICTED: versican core protein-like [Xiphophorus maculatus]  clstr ali  26  323.......PCSVNDCLNGGSCFEKGPVNICVCTPGFSGLHCE-TDVDECNSNPCLNGATCLDRVNSFTCLCLPSYTGELCEQDTE. 398
103 3.000e-20gi|974110706|ref|XP_015254540.1| PREDICTED: hepatocyte growth factor activator isoform X1 [Cyprinodon variegatus]  clstr ali  34  131.QKKCYEAAHLRHYDIGESWGRIHLRNVEQCTCEAGEISCQRVHYRMCRRNPCKNQGTCITSTGKEVCFCKMGYSGPDCSLVPE. 215
104 4.000e-20gi|47212549|emb|CAF94998.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  35  40...RCYETSHLRYFDAGESWGRIHLRNVEQCTCAAGQVSCEKVRYTACRSNPCHNDGTCISSTGREVCSCRHGYGGAHCGVDLDS 123
105 5.000e-20gi|929269151|ref|XP_014011203.1| PREDICTED: hepatocyte growth factor activator-like isoform X1 [Salmo salar]  clstr ali  33  145...KCYETIHLRYYDVGKSWGRIYLRNVERCTCVDGEISCERVRYTVCSENPCENDGTCITATREEVCACRPGYSGPYCSI.... 224
106 8.000e-20gi|929269153|ref|XP_014011205.1| PREDICTED: hepatocyte growth factor activator-like isoform X2 [Salmo salar]  clstr ali  33  145...KCYETIHLRYYDVGKSWGRIYLRNVERCTCVDGEISCERVRYTVCSENPCENDGTCITATREEVCACRPGYSGPYCSI.... 224
107 1.000e-19gi|780146338|ref|XP_011681401.1| PREDICTED: fibropellin-1-like [Strongylocentrotus purpuratus]  clstr ali  20  199......NDCSPY-----AQCMNTDGSYECTCLPGYEGRNC--TDINECSPDPCLNGATCSDGVNGYTCTCADGYSGDDCGTDI.. 277
108 1.000e-19gi|260803838|ref|XP_002596796.1| hypothetical protein BRAFLDRAFT_211833 [Branchiostoma floridae]  clstr ali  30  2..........................YSCTCAPGYTGVHCE-TDIDECASNPCRNGGTCTDGVNSYTCVCRPGFTGTHCETDV.. 57
109 1.000e-19gi|537273593|gb|ERE92477.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  29  115....CRDEQTQTTYQHLQSWLRLRSSRVEYCRCNGGSTQCHSVPVRSCSEPRCFNGGTCQQYFSDFVCQCPDGFVGKRCDIDTRA 199
110 1.000e-19gi|961911415|ref|XP_014905838.1| PREDICTED: hepatocyte growth factor activator isoform X1 [Poecilia latipinna]  clstr ali  34  181.QKKCYEASHLRHYNIGESWGRIHLRNVERCTCEAGEVSCQSVHYTKCRRNPCKNQGICITSTGKEVCYCRNGYSGPDCSLVPE. 265
111 1.000e-19gi|543270942|ref|XP_005424804.1| PREDICTED: hepatocyte growth factor activator [Geospiza fortis]  clstr ali  31  140..KKCFDNSLYEFFDEGASWSRVHRGAVEQCMCAHGQMECGRVEHKSCVHDPCMNGGECVASTGNIVCDCKENYAGKYCNIVPS. 223
112 1.000e-19gi|831556796|ref|XP_012730165.1| PREDICTED: hepatocyte growth factor activator [Fundulus heteroclitus]  clstr ali  33  132.QKKCYEAAHLRHYDTGESWGRIHLRNVEQCTCEAGEISCQRVHYTKCLKNPCKNQGTCITSTGKEACYCKHGYGGPDCSLVPE. 216
113 2.000e-19gi|749798536|ref|XP_011152770.1| PREDICTED: neurogenic locus protein delta [Harpegnathos saltator]  clstr ali  21  288...QDLNYCTNHPCMNGGTCFNTGGSYTCSCPSGFTGADCQ-TPLFDCHSKPCMNGGTCHHHITGYRCTCPPGWRGRHCEI.... 367
114 2.000e-19gi|1007722197|ref|XP_015802394.1| PREDICTED: hepatocyte growth factor activator [Nothobranchius furzeri]  clstr ali  32  136.QKTCYETLHLHHYDIGESWGRIHLRNVEQCTCVAGEIECQRVHYTKCSMNPCQNHGTCISSTGKQVCHCRFGFDGPRCSI.... 217
115 2.000e-19gi|701370616|ref|XP_009986583.1| PREDICTED: hepatocyte growth factor activator [Tauraco erythrolophus]  clstr ali  31  136..KKCFDDSLYEFFDMDVSWSRVREGAVEQCVCVNGEIECESVEHKSCFHDPCMNGGECKMVTGKTVCDCKGNYAGKYCNIVPS. 219
116 2.000e-19gi|641782183|ref|XP_008173590.1| PREDICTED: hepatocyte growth factor activator [Chrysemys picta bellii]  clstr ali  30  151...KCFDESRYEYFDTGESWARIHKGIVEECTCVNSGIECQNTRYTSCTSNPCLHDSACIVFTGKTICGCKENFVGKYCNI.... 230
117 3.000e-19gi|768924319|ref|XP_011604959.1| PREDICTED: hepatocyte growth factor activator isoform X1 [Takifugu rubripes]  clstr ali  33  143.HKKCYETTHLHYYDTGESWGRIHLRNVEQCTCMAGEIKCERVGYTTCRSNPCQNDGACIVSTGQEVCYCRRGYSGPHCSVELDS 228
118 3.000e-19gi|537273594|gb|ERE92478.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  29  115....CRDEQTQTTYQHLQSWLRLRSSRVEYCRCNGGSTQCHSVPVRSCSEPRCFNGGTCQQYFSDFVCQCPDGFVGKRCDIDTRA 199
119 3.000e-19gi|831328275|ref|XP_012697340.1| PREDICTED: hepatocyte growth factor activator [Clupea harengus]  clstr ali  41  126...KCFEETHLRHYDSEEAWGRISNRKVEQCTCLDGKALCERTRYTACSWNPCENEGTCIEATGEEVCACQPGYSGPFCSI.... 205
120 3.000e-19gi|701411172|ref|XP_009998573.1| PREDICTED: hepatocyte growth factor activator [Chaetura pelagica]  clstr ali  34  136..EKCFDNSLYQFFDVDMSWPRVQQGAVEECKCVNGQIECKHVEHRRCTHDPCMNGGECKMVSGEIVCDCKENYAGKYCNIVPS. 219
121 4.000e-19gi|817321339|ref|XP_012331357.1| PREDICTED: tissue-type plasminogen activator [Aotus nancymaae]  clstr ali  29  92....CRDEKMQMIYQQHESWLRIRSNRVEYCWCNSGRAQCHSVPIKSCSEPRCFNGGTCRQYFSDFVCQCPEGFTGKRCEIDTKA 176
122 5.000e-19gi|213512232|ref|NP_001133611.1| hepatocyte growth factor precursor [Salmo salar]  clstr ali  34  145...KCYETIHLRYYDIGESWGRIYHRNVERCTCVDGEISCERVRYTVCSDNPCENDGTCITATREEVCACRPGYSGPYCSIVPEA 228
123 6.000e-19gi|734615841|ref|XP_010735533.1| PREDICTED: hepatocyte growth factor activator [Larimichthys crocea]  clstr ali  31  137.HKKCYETIHLRYYDTGESWGRIHLRNVEQCTCMAGEIKCERARYTKCHSNPCQNDGACIIATGKEVCSCQRGYSGRYCSIEPE. 221
124 6.000e-19gi|530576753|ref|XP_005282343.1| PREDICTED: coagulation factor XII [Chrysemys picta bellii]  clstr ali  45  126..ESCFEEHLLVYFLEGEKWLRYRPPSVEECHCAAGKTVCRPAHGKACPTNPCLNGGHCMEVKREWVCSCQSGYVGPFCDID... 205
125 8.000e-19gi|830031324|ref|XP_004682333.2| PREDICTED: tissue-type plasminogen activator [Condylura cristata]  clstr ali  28  41....CRDEKTQMVYLHHESWLRIRSNRVEYCRCNSGQAQCHSVPIKGCSEPRCFNGGTCWQYFSDFVCQCPEGFVGKRCEIDTRA 125
126 8.000e-19gi|513185002|ref|XP_420819.4| PREDICTED: hepatocyte growth factor activator [Gallus gallus]  clstr ali  34  136..KKCFDDSLYEFFDVDVSWSRVKQGAVEQCICVDGQMECQRVEHKSCVHDPCMNGGECIAFSGRTVCDCKEPFVGKYCNI.... 216
127 8.000e-19gi|514730973|ref|XP_005016246.1| PREDICTED: hepatocyte growth factor activator [Anas platyrhynchos]  clstr ali  32  137...KCFDNSLYEYFDVGMTWSRVQQGAVEQCTCVDGEIECQSIKHERCVRDPCMNGGECKMITSNRVCDCKRNFVGKYCNI.... 216
128 9.000e-19gi|704230354|ref|XP_010146109.1| PREDICTED: hepatocyte growth factor activator [Eurypyga helias]  clstr ali  32  78..KKCFDNSLYEFFDVGVSWSRVQQGAVEQCVCVNGQSECERVEHRSCVHDPCVNAGECKMVTGKIVCDCKGNYVGKYCNIVPS. 161
129 9.000e-19gi|557295348|ref|XP_006030080.1| PREDICTED: hepatocyte growth factor activator [Alligator sinensis]  clstr ali  32  138...KCFDESLYEHFDLGESWARVHRGAVEQCMCINGQIECHAARYTDCIHDPCLHNSSCISFTGQTVCSCRGDYVGKYCNI.... 217
130 1.000e-18gi|130492452|ref|NP_001076238.1| tissue-type plasminogen activator precursor [Oryctolagus cuniculus]  clstr ali  32  42....CVDQQTQLTYQRRESWLRLRGNRVEYCRCSSGGPRCHSVPVQSCSEPRCLNGGTCSQYFSDFVCQCPEGFVGKRCEVDTRA 126
131 1.000e-18gi|591370566|ref|XP_007060106.1| PREDICTED: hepatocyte growth factor activator [Chelonia mydas]  clstr ali  30  107...KCFDDSRYEYFDTGESWARIHKGIVEECMCVNSRIECQNTRYTSCTNNPCLHDSACIVFTGKTICGCKENFVGKYCNI.... 186
132 1.000e-18gi|657736767|ref|XP_008319760.1| PREDICTED: LOW QUALITY PROTEIN: hepatocyte growth factor activator [Cynoglossus semilaevis]  clstr ali  29  136...RCYETLHQRYYDTGASWGRIHLRNVEQCTCVAGEISCERVRYTMCRSNTCHNGGTCITSTGKEVCNCRHGFSGSDCGLEPEA 219
133 2.000e-18gi|1009388608|gb|KYN10606.1| Neurogenic locus protein delta [Trachymyrmex cornetzi]  clstr ali  21  415...QDLNYCTNHPCMNGGTCFNTGGSYTCSCPSGFTGTECQ-TPLFDCHSKPCLNGGTCQQHRRSYRCTCPPGWRGRHCEI.... 497
134 2.000e-18gi|768388185|ref|XP_011589580.1| PREDICTED: hepatocyte growth factor activator isoform X4 [Aquila chrysaetos canadensis]  clstr ali  33  137...KCFDNSLYEFFDVGMSWSRVQQGAVEQCMCVNGQIECRSVEHKSCVHDPCMNGGECKMVTGKIVCDCKGNYAGKYCSIVPS. 219
135 3.000e-18gi|697515463|ref|XP_009684474.1| PREDICTED: hepatocyte growth factor activator [Struthio camelus australis]  clstr ali  36  136..KKCFDDSLHEFFDMDMSWSRTQQGVVEQCVCVDGHTECQQIEHQSCIQNPCLNGGECKMITFNRVCDCKGDYVGKYCNIVPS. 219
136 3.000e-18gi|597735885|ref|XP_007230211.1| PREDICTED: hepatocyte growth factor activator [Astyanax mexicanus]  clstr ali  34  143...KCYESLHLRYYDIEESWGRIHKRNVELCRCLREGVSCERVRYRVCQNNPCQNDGTCIEATGEEVCACRMGYSGAHCSI.... 222
137 4.000e-18gi|657584922|ref|XP_008296633.1| PREDICTED: hepatocyte growth factor activator [Stegastes partitus]  clstr ali  33  140.QKKCYETTHLRYYDIGESWGRIHLRNVEQCTCVAGEIKCERDRYTMCPTNPCQNEGACITATGKEVCNCRSGYSGPYCSFEPE. 224
138 4.000e-18gi|926697532|ref|XP_013820833.1| PREDICTED: coagulation factor XII [Capra hircus]  clstr ali  60  133..EKCFEPQFFRFFHEDEIWHRLEPAGVVKCQCKGPHAQCKPLASQVCRTNPCLNGGTHVQ---NSASAPPRGYRNP--DNDT.. 208
139 1.000e-17gi|431896110|gb|ELK05528.1| Delta-like protein 4 [Pteropus alecto]  clstr ali  22  335........CADSPCFNGGSCRNQGASYACECPPSFTGSNCEK-KVDRCTSNPCANGGQCLNRGPNRICRCRPGFTGTHCELHI.. 410
140 2.000e-17gi|759038681|ref|XP_011351883.1| PREDICTED: neurogenic locus protein delta [Cerapachys biroi]  clstr ali  23  290...QDLNYCTNHPCLNGGTCFNTGGSYTCSCPSGFTGTDCQ-TPLFDCHSKPCLNGGTCQHHRGGYRCTCPPGWRGRHCEI.... 389
141 2.000e-17gi|999990982|gb|KXJ30000.1| Fibropellin-1 [Exaiptasia pallida]  clstr ali  32  266..............................CCPGWEGSEC-SLKIDECASNPCKNGASCNDLVNGYNCTCVXGYEGSNCEVDI.. 322
142 2.000e-17gi|1002586795|ref|XP_015672016.1| PREDICTED: tissue-type plasminogen activator [Protobothrops mucrosquamatus]  clstr ali  32  46...RCRDPFTKQTYTQKESWLRRVKGRTEYCRCENSGIFCHAVPVKGCIKPLCLHGGRCLYSPNLFICFCPPGFSGKFCEIDTRA 130
143 2.000e-17gi|699633359|ref|XP_009908400.1| PREDICTED: hepatocyte growth factor activator [Picoides pubescens]  clstr ali  29  136..KKCFDNSLYEFFDVGVSWTSIQHGAVEECTCVNGHTECRSIAHTSCLHDPCMNGGECRMATGKIVCDCKGNFAGKYCNIVPS. 219
144 4.000e-17gi|975097392|ref|XP_015263654.1| PREDICTED: tissue-type plasminogen activator [Gekko japonicus]  clstr ali  30  39....CRDPSTQRVYQQRESWLRRANSRVEYCRCESGRSRCHAVPVKACAQQQCYNRGICLYSPGHFVCSCLPGFSGKQCEIDAEA 122
145 5.000e-17gi|699249938|ref|XP_009860768.1| PREDICTED: fibropellin-3-like [Ciona intestinalis]  clstr ali  17  395...TNIDDCASTPCLNGGTCTDGVASFTCACVNGYIGDICEHCETDLCEPNPCNNSGSCVRAVESFTCDCQPAFTGQLC...... 502
146 5.000e-17gi|585710974|ref|XP_006824651.1| PREDICTED: uncharacterized protein LOC102808514, partial [Saccoglossus kowalevskii]  clstr ali  18  125...TNIDDCDPNPCLNGGVCEDGINDYTCTCPEGYTGDICQTVLPPSCDIN---NGGNCHDGTGRY-CSCNTGY........... 197
147 5.000e-17gi|1020564472|ref|XP_016112370.1| PREDICTED: hepatocyte growth factor activator-like isoform X1 [Sinocyclocheilus grahami]  clstr ali  30  157..KKCYEPLHLKYYDTGDSWGRIYLRSVELCTCLSGGVSCERARYTVCSRNRCENNGVCIEATGEEVCGCVSGYNGQYCNINP.. 239
148 5.000e-17gi|946616207|ref|XP_014424049.1| PREDICTED: tissue-type plasminogen activator [Pelodiscus sinensis]  clstr ali  27  38....CTDRSSRQIYQQRETWLRLMGGRVEYCACDNGRSRCHSVPVRSCADQKCYNGGRCKQALYHFICQCHAGFSGKHCEIDMEA 121
149 5.000e-17gi|1011588869|gb|KYO34706.1| tissue-type plasminogen activator [Alligator mississippiensis]  clstr ali  28  65....CRDSSFQQIYQPGQTWLRLAGSRVEYCRCEGRQSLCHTVPVRTCTERKCYNGGRCLYSPQHFICLCRRGFSGQQCEIDTE. 147
150 5.000e-17gi|612032796|ref|XP_007496872.1| PREDICTED: hepatocyte growth factor activator [Monodelphis domestica]  clstr ali  30  149...KCFDETRYEYFDIDESWARIHQGVVEWCSCSRGHIDCETIRYTACVNNPCLHDSVCIVSTGKTICGCHGINVGKYCNIVPS. 231
151 5.000e-17gi|637357393|ref|XP_008119511.1| PREDICTED: tissue-type plasminogen activator [Anolis carolinensis]  clstr ali  27  43....CKDQTTQQVYQQRESWLRQANRRIEYCRCESRGISCHAVPVEGCLKPRCFNGGRCLYSSNLFICLCPPGFSGKHCEIDAKA 126
152 8.000e-17gi|557000181|ref|XP_006002908.1| PREDICTED: tissue-type plasminogen activator [Latimeria chalumnae]  clstr ali  30  33.SDKCMDRETSQIYHHGETWLRFAGTLVEYCRCMNRVSRCYAVPVMDCFENRCFHGGICKEALYSFICKCPSGFSGKQCEIEETA 118
153 9.000e-17gi|928030815|ref|XP_013863844.1| PREDICTED: versican core protein-like, partial [Austrofundulus limnaeus]  clstr ali  28  33.............CQNGGSCYKS-GSSVCSCNCPGYTGHQCETEIDECQSNPCRNGGTCIDGLTSFTCICLPSYSGLYCEEDTE. 103
154 1.000e-16gi|260814370|ref|XP_002601888.1| hypothetical protein BRAFLDRAFT_124580 [Branchiostoma floridae]  clstr ali  30 2051...........................SCQCPAGGSGT-C--SNINECASNPCQNGGFCNDETNRYSCSCPSGYGGTNCQINI.. 2109
155 2.000e-16gi|637328242|ref|XP_008114135.1| PREDICTED: hepatocyte growth factor activator isoform X1 [Anolis carolinensis]  clstr ali  33  87...KCFDETLYEYFESGKTWARIYQGTVQHCTCINSLVECQREQYTDCAINPCLQGGACRRTTNRTVCGCRDPFVGKYCNI.... 166
156 2.000e-16gi|637328246|ref|XP_008114136.1| PREDICTED: hepatocyte growth factor activator isoform X2 [Anolis carolinensis]  clstr ali  33  87...KCFDETLYEYFESGKTWARIYQGTVQHCTCINSLVECQREQYTDCAINPCLQGGACRRTTNRTVCGCRDPFVGKYCNI.... 166
157 3.000e-16gi|1005461904|ref|XP_015768009.1| PREDICTED: fibropellin-1-like isoform X3 [Acropora digitifera]  clstr ali  18  190.CEEDVDECLQVSCGNG-TCFDRINNFSCVCDVGYMGRHCDVVDIDDCGNHTCANGASCVDGINRYSCLCTTGFIGRYCEIDID. 310
158 4.000e-16gi|391337526|ref|XP_003743118.1| PREDICTED: uncharacterized protein LOC100906063 [Metaseiulus occidentalis]  clstr ali  24 2460........CIGDPCMHGSSCQDYGSGLNCSCSEEFAGIGCQ-YEFDACAENVCQNGGKCQRSGKTYVCDCPPGYGGKMCEQDI.. 2533
159 4.000e-16gi|637270435|ref|XP_008103178.1| PREDICTED: coagulation factor XII isoform X1 [Anolis carolinensis]  clstr ali  40  129..ESCFGAQRPPHIGMKDTWLRYHQAGLEECHCFGKDIACRPVHGKDCATNPCLNGGLCLELKSSWVCGCPEGFSGSLCDID... 209
160 4.000e-16gi|345306462|ref|XP_003428469.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Ornithorhynchus anatinus]  clstr ali  27  36....CMDYTTKKVYQQRESWLRHRGAQLEYCRCDSGLARCHTVPGKACSQQMCYNGGTCYQYFSDFICSCPSGFDGKQCEINVNA 118
161 5.000e-16gi|975095407|ref|XP_015262573.1| PREDICTED: hepatocyte growth factor activator [Gekko japonicus]  clstr ali  33  53...KCFDGSLYEYFETGKSWARIHQGIVQECTCVHSQVECRPAPSTGCTTNPCLHSRLCITSTGETVCECQKPFVGRDCNIDP.. 134
162 5.000e-16gi|602677601|ref|XP_007444246.1| PREDICTED: tissue-type plasminogen activator-like, partial [Python bivittatus]  clstr ali  29  41...KCRDPFTKQIYNQRESWLRRAKERIEYCRCEDNGISCHAVPIRGCIKPLCFNGGRCLYSPNFFICFCPPGFTGKYCEI.... 121
163 7.000e-16gi|951565276|ref|XP_014481474.1| PREDICTED: neurogenic locus protein delta-like [Dinoponera quadriceps]  clstr ali  20  288...QDLNYCTNHPCVNGGTCFNTGGSYTCSCPSGFTGTDCQ-TPLFDCHSKPCMNGGTCSSYANGYRCTCPPGWRGRHCEI.... 381
164 7.000e-16gi|726999860|ref|XP_010390143.1| PREDICTED: delta-like protein 1 [Corvus cornix cornix]  clstr ali  29  166....................RDLENSYSCTCPPGFYGKNCELSAMT-CADGPCFNGGRCTDNPGGYSCRCPLGYSGFNCEKKID. 229
165 8.000e-16gi|919057069|ref|XP_013410358.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Lingula  clstr ali  25 2570.CEQKVNFCSVSPCQNGGTCENGVSDFACRCPEKFTGKTCSQV-VAVCDVNPCDNGGRCVDGNGDFTCYCSGLYSGKLCD..... 2648
166 8.000e-16gi|528486499|ref|XP_002667717.3| PREDICTED: hepatocyte growth factor activator-like, partial [Danio rerio]  clstr ali  35  230...KCYELLHLKHYDIGESWSRIYLRSVEMCTCVSAGAVCERTRYTVCSRNPCENDGVCIEATGEEVCGCISGYTGQYCNI.... 309
167 8.000e-16gi|1351380|sp|P15638.2|URT2_DESRO RecName: Full=Salivary plasminogen activator alpha 2; AltName: Full=BAT-PA; AltName: Full=DSPA alpha-2; AltName: Fu  clstr ali  33  42....CRDEKTQMIYQQQESWLRPESKRVEHCRCDRGLAQCHTVPVKSCSELRCFNGGTCWQAASDFVCQCPKGYTGKQCEVDTHA 126
168 9.000e-16gi|507570942|ref|XP_004669074.1| PREDICTED: tissue-type plasminogen activator [Jaculus jaculus]  clstr ali  31  38....CRDEQTQMTFQQHESWLRLRSRRVEYCWCNSGRAQCHSVPVKGCSEPRCFNGGTCWQYFSDFVCQCPDGFVGKRCDIDT.. 120
169 1.000e-15gi|1005964651|ref|XP_015790438.1| PREDICTED: uncharacterized protein LOC107367263 isoform X1 [Tetranychus urticae]  clstr ali  18 2541.............CANGATCRDLGDDYQCLCPPGWMGKNC-DIDVPDCGPNSCPPTATCVDLTNGFYCKCPFNMTGEDC...... 2605
170 1.000e-15gi|831244910|ref|XP_012667679.1| PREDICTED: tissue-type plasminogen activator [Otolemur garnettii]  clstr ali  30  38....CRDEKTQMVYQLHESWLRLRGRRVEYCWCDGNRARCHSVPVKSCSEPRCFNGGTCWQYFSHFVCQCPEGFTGTRCEIDARA 122
171 1.000e-15gi|301615068|ref|XP_002937000.1| PREDICTED: coagulation factor XII [Xenopus tropicalis]  clstr ali  31  166.TDKCFDKKSLQYFNPKDEWLRYSPPVLEKCGCTEKGVVCKQTHGMACSKNLCLHGGRCIQHNKMTACGCSPGFIGTHCEI.... 245
172 1.000e-15gi|975105310|ref|XP_015267986.1| PREDICTED: coagulation factor XII [Gekko japonicus]  clstr ali  36  93..ESCFESLGRLHIGEKETWLRYQPAGLEECHCAGKKIVCKPVYGKACTSNPCLNGGHCIMLKQGWVCGCPGRFSGPLCDID... 173
173 2.000e-15gi|1005483428|ref|XP_015778390.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Acropora digitifera]  clstr ali  25  161....NVDDCASSPCNNGGTCFDRVGSFFCSCTANYTGLTCQHE--DQCKTKPC-HGGICRTGPGGYSCRCSAGWTGQNCSVDID. 243
174 3.000e-15gi|641934532|emb|CDR18802.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  33  2............................CSCRGGFTGPNCE-TDINDCAPNPCLSGGSCTDGVNSFHCSCLPGFTGPRCAVEV.. 55
175 3.000e-15gi|208879560|gb|ACI31317.1| plasminogen activator [Carollia perspicillata]  clstr ali  30  42....CRDEKTQMTYRQHESWLRLRSNRVEHCWCDSGRAQCHSVPIRSCNEPRCFNGGTCRQYFSDFVCQCPEGYTGKLCEVDASA 126
176 3.000e-15gi|667266766|ref|XP_008569429.1| PREDICTED: tissue-type plasminogen activator [Galeopterus variegatus]  clstr ali  25  42....CRDETSQATYQQQESWLRPAPDRVEYCWCSSGRPQCHSVPVKSCSEQRCFNGGTCRQYFSDFVCQCPEGFVGKRCEIDASA 126
177 4.000e-15gi|602655599|ref|XP_007433545.1| PREDICTED: hepatocyte growth factor activator [Python bivittatus]  clstr ali  30  46...KCFDDTLYEYFEIGESWATIHQGLVQACTCVNSTTSCHPEQYTDCPSDPCLHGRSCILASNSIVCACSRLFRGRFCNM.... 125
178 5.000e-15gi|921295256|ref|WP_053230641.1| hypothetical protein [Sandaracinus amylolyticus]  clstr ali  21  179.CETDIDECSPNPCHNGGSCVEGVATFMCTCAPGYLGPRCEID--DACAPNPCRNGGFCT......................... 235
179 5.000e-15gi|1005968229|ref|XP_015791917.1| PREDICTED: neurogenic locus Notch protein-like [Tetranychus urticae]  clstr ali  25  34.............................QCPRGFKGNHCE-INIDDCEGNLCQNGATCIDGIASYTCQCTPQFSGKFCSKDVD. 87
180 5.000e-15gi|542179783|ref|XP_005495991.1| PREDICTED: tissue-type plasminogen activator [Zonotrichia albicollis]  clstr ali  26  43....CTDNSSAEIYQHGGIWLRLSGSRIEYCRCDSGRSWCHTVPATVCTRNKCYNGGRCSQAYYSFVCQCHPGFSGKQCEIDT.. 124
181 7.000e-15gi|507652465|ref|XP_004633125.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Octodon degus]  clstr ali  29  38....CRDEKTQTTYQQNESWLRPQLRRVEFCWCKGGRPQCHSVPVKSCSEPRCFNGGTCRQYFSDFVCQCPEGFMGKRCEIDS.. 120
182 8.000e-15gi|344238919|gb|EGV95022.1| Salivary plasminogen activator alpha 2 [Cricetulus griseus]  clstr ali  29  241....CRDEQTQTTYQHLQSWLRLRSSRVEYCRCNGGSTQCHSVPVRSCSEPRCFNGGACQQYFSDFVCQCPDGFVGKRCDIDTRA 325
183 9.000e-15gi|919081036|ref|XP_013421640.1| PREDICTED: keratin, type I cytoskeletal 9-like [Lingula anatina]  clstr ali  34  10.........................................HEDIDECAIQPCKNGATCYDGVNSYICMCPPGYTGQTCDTDID. 52
184 9.000e-15gi|431902225|gb|ELK08726.1| Tissue-type plasminogen activator [Pteropus alecto]  clstr ali  25  60....CRDEKTQMTYRQHESWLRLRSNRVEYCWCNSGQSQCHSVPVKGCNEPRCFNGGTCRQYFSDFVCQCPEGFSGKLCEIDASA 144
185 1.000e-14gi|505796193|ref|XP_004606976.1| PREDICTED: tissue-type plasminogen activator [Sorex araneus]  clstr ali  26  60....CRDETTQMTYQQHQSWLRIRYSRVEYCRCSWNGLQCHSVPVKGCSEPRCFNGGTCWQYFSDFVCQCPDGFAGKYCEVDT.. 142
186 1.000e-14gi|545878910|ref|XP_005657704.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Sus scrofa]  clstr ali  27  57....CRDEKTQMIYQQHQSWLRLRGNRVEHCWCNDGQTQCHSVPVKSCSEPRCFNGGTCLQAVYDFVCQCPVGFIGRQCEIDARA 141
187 1.000e-14gi|676283119|gb|KFO36418.1| Tissue-type plasminogen activator [Fukomys damarensis]  clstr ali  28  142....CRDEKTQMTYQQHESWLRLRGNRVEFCWCNGGRPQCHSVPIKGCSEPRCFNGGICRQYFSDFVCQCPQGFMGKRCEIDTRA 226
188 1.000e-14gi|847110146|ref|XP_012814580.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Xenopus tropicalis]  clstr ali  30  76....CVERSSGRIYKLGDTWLRPAGKRTEFCRCDNGLSRCHSVPVTDCAEQKCYNGGRCQQAVYHHLCRCPSGFKGEHCETDTK. 157
189 1.000e-14gi|504165749|ref|XP_004592804.1| PREDICTED: tissue-type plasminogen activator [Ochotona princeps]  clstr ali  32  29....CVEQRMQLTFQLLESWLRLRSNRVEYCRCTSSGPRCHSVPVKSCSEPRCLNGGTCWQAQSDFVCQCPEGFVGKRCDVDT.. 111
190 1.000e-14gi|675427144|ref|XP_008927421.1| PREDICTED: tissue-type plasminogen activator [Manacus vitellinus]  clstr ali  26  37....CKDSSSGEVFQHGWTWLRLAGSRIEYCRCDSGQRRCHTVPVRACTRNKCYNGGQCSQAYYSFICQCHQGFSGKQCEIDTE. 119
191 2.000e-14gi|871258718|ref|XP_005106962.2| PREDICTED: uncharacterized protein LOC101853965 [Aplysia californica]  clstr ali  28  407..........................................IDIDDCSPDPCQNGATCVDQVNDYRCVCGPGYTDKNCSTDID. 448
192 2.000e-14gi|194374979|dbj|BAG62604.1| unnamed protein product [Homo sapiens]  clstr ali  27  41....CRDEKTQMIYQQHQSWLRLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQYFSDFVCQCPEGFAGKCCEIDTRA 125
193 2.000e-14gi|562823864|ref|XP_006141725.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Tupaia chinensis]  clstr ali  29  38....CRDEQTQTTYQLHEAWLRLRGNRVEYCRCMSGRPLCHSVPVKSCSEPRCFNGGACRQYFSDFVCQCPEGFVGKRCEVDTRA 122
194 2.000e-14gi|545878907|ref|XP_005657703.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Sus scrofa]  clstr ali  27  57....CRDEKTQMIYQQHQSWLRLRGNRVEHCWCNDGQTQCHSVPVKSCSEPRCFNGGTCLQAVYDFVCQCPVGFIGRQCEIDARA 141
195 2.000e-14gi|640793626|ref|XP_008052797.1| PREDICTED: tissue-type plasminogen activator [Tarsius syrichta]  clstr ali  29  38....CRDEKTQMTYQHHESWLRLRSSRVEYCWCNGGRPQCHSVPVKSCSEPRCFNGGTCWQYFSDFVCQCPEGYLGKRCEVD... 119
196 2.000e-14gi|902923139|ref|XP_013049855.1| PREDICTED: tissue-type plasminogen activator isoform X4 [Anser cygnoides domesticus]  clstr ali  25  38....CTDYSSGEIYQHRGSWLRLSRSRIEYCRCDNGRSRCHTVPIRACTKNKCYNGGQCSQAYYSFICQCHQGFSGKQCEIDTE. 120
197 2.000e-14gi|208879564|gb|ACI31319.1| plasminogen activator [Diaemus youngi]  clstr ali  32  42....CKDEKTQMTYRQQESWLRVRGNGVEYCRCDSGRAKCHTVPIKSCSEPRCFNGGTCWEAFSEFVCQCPERYTGKWCEVDTHA 126
198 2.000e-14gi|488596122|ref|XP_004483245.1| PREDICTED: tissue-type plasminogen activator [Dasypus novemcinctus]  clstr ali  27  42....CRDEKTQMVYRQHESWLRLRSNRVEYCWCNGGRSQCHSVPVKSCSEPRCFNGGTCLQYFSDFVCQCPEGFVGKSCEIEASA 126
199 2.000e-14gi|931575219|ref|XP_008975163.2| PREDICTED: tissue-type plasminogen activator isoform X1 [Pan paniscus]  clstr ali  27  128....CRDEKTQMIYQQHQSWLRLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQYFSDFVCQCPEGFAGKCCEIDTRA 212
200 3.000e-14gi|884952273|ref|XP_012989336.1| PREDICTED: protein eyes shut homolog [Esox lucius]  clstr ali  27  4...............................MAGFEGTRCE-IDTEECISGPCQNQGRCLDGVNSYSCYCEPGFSGQHCEEDI.. 54
201 3.000e-14gi|780155488|ref|XP_011682310.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Strongylocentrotus pu  clstr ali  35  204...........................................DINDCASYPCQNGGACLDGLDSYTCNCAKGYDGANCESDI.. 243
202 3.000e-14gi|1016643745|ref|XP_016043477.1| PREDICTED: tissue-type plasminogen activator [Erinaceus europaeus]  clstr ali  28  38....CTDEETHMTYQQHQSWLRVRNNRVEYCWCNSGRPKCHSVPVRGCREPRCFNGGTCQQALYDFVCQCPEGFTGKLCEVDATA 122
203 3.000e-14gi|345781617|ref|XP_539955.3| PREDICTED: tissue-type plasminogen activator [Canis lupus familiaris]  clstr ali  27  42....CRDEKTQTQYGPSESWLRPGLRGVEYCRCAGGRPQCHSVPVRGCSEPRCFNGGTCRQALYDFVCQCPEGFLGKRCEIDAGA 126
204 3.000e-14gi|927184451|ref|XP_013927174.1| PREDICTED: coagulation factor XII [Thamnophis sirtalis]  clstr ali  34  126.TEGCFGSQRGLHVGKKETWLQYFPSGLKECRCNRKKILCKTVHGKACRSNPCLNGGQCIQLGQNLVCSCPEKFSGPLCDID... 207
205 3.000e-14gi|821460924|ref|XP_003758079.2| PREDICTED: tissue-type plasminogen activator [Sarcophilus harrisii]  clstr ali  25  37....CKDEKTQMIYQQKQTWLRPGLRRVEFCRCDSGYTRCHSVPVQSCSEPRCFNGGTCQQYFSDFICQCPRGFSGKQCEIDNKA 121
206 3.000e-14gi|852730135|ref|XP_012881939.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Dipodomys ordii]  clstr ali  25  41....CRDEETQMTYEQRESWLRLRGNRVEYCWCNSGRSQCHSVPVKGCTQPRCFNAGTCWQYFSDFVCQCPEGFVGKRCEIDTRA 125
207 4.000e-14gi|260821932|ref|XP_002606357.1| hypothetical protein BRAFLDRAFT_67600 [Branchiostoma floridae]  clstr ali  1245.CETDINDCSPNPCQHDGDCTDRVNGFSCSCKPGYAGDTCE-TDLD....................................... 1288
208 4.000e-14gi|632936980|ref|XP_007896862.1| PREDICTED: urokinase-type plasminogen activator [Callorhinchus milii]  clstr ali  33  37..DKCVESPT-EIYRRGQSWLRLYESEIQKCTCT-RRTLCYNVRTKDCSTNKCFHGGRCASQSEHYLCLCPAGYRGKHCEIDV.. 117
209 4.000e-14gi|972948885|ref|XP_015197397.1| PREDICTED: tissue-type plasminogen activator [Lepisosteus oculatus]  clstr ali  30  36..ELCADSGTGETHSPGETWLRWQGQRVEFCGCTRGTARCHTVPVVTCYLPRCYNGGTCKEAVYSFICQCPPGFTGPQCEINTT. 119
210 4.000e-14gi|562823862|ref|XP_006141724.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Tupaia chinensis]  clstr ali  29  38....CRDEQTQTTYQLHEAWLRLRGNRVEYCRCMSGRPLCHSVPVKSCSEPRCFNGGACRQYFSDFVCQCPEGFVGKRCEVDTRA 122
211 5.000e-14gi|528766202|gb|EPY85861.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 precursor [Camelus ferus]  clstr ali  28  960....................................GQLCEE-NINECSSSPCLNKGTCVDGVAGYRCTCVKGYMGLHCETEV.. 1005
212 6.000e-14gi|780120895|ref|XP_011677910.1| PREDICTED: neurogenic locus notch homolog protein 1 [Strongylocentrotus purpuratus]  clstr ali  263...TNIDECSSDPCQNGGTCEDGVNGYVCICVDGWGGGDCEDYDV........................................ 304
213 6.000e-14gi|1005427002|ref|XP_015751298.1| PREDICTED: uncharacterized protein LOC107331246 isoform X3 [Acropora digitifera]  clstr ali  30  188.............................................NECESFPCLNNGTCWEKVRGYQCNCTAGFNGSQCEMNID. 226
214 6.000e-14gi|611981376|ref|XP_007476457.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Monodelphis domestica]  clstr ali  25  37....CKDEKTQMIYQQKQSWLRPGLRGVEYCRCDSGFIRCHSVPVQNCSEPRCFNGGTCKQALYDFICHCPRGFAGKQCEIDSNS 121
215 7.000e-14gi|1005426994|ref|XP_015751294.1| PREDICTED: uncharacterized protein LOC107331246 isoform X1 [Acropora digitifera]  clstr ali  30  188.............................................NECESFPCLNNGTCWEKVRGYQCNCTAGFNGSQCEMNID. 226
216 7.000e-14gi|768949964|ref|XP_011614089.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Takifugu rubripes]  clstr ali  27  64....CVDSKTSAMRSSGETWLRWRGQRVEYCRCARGRELCHIVPVISCYTSQCYNGGTCKEYTSDYICQCPTGFSGTHCEINT.. 144
217 8.000e-14gi|762143427|ref|XP_011454964.1| PREDICTED: sodium- and chloride-dependent glycine transporter 1-like [Crassostrea gigas]  clstr ali  10  472.CENNIDDCESQPCQNNGTCTDMINDYLCHCTVGFNGRNC............................................. 510
218 9.000e-14gi|919012497|ref|XP_013390714.1| PREDICTED: fibropellin-1-like [Lingula anatina]  clstr ali  20 1193.......PCSSYPCKNGAQCKNQLGGYQCKCPPFYTGKHCEG-HINFCQPNPCQHGFTCAPKLGGYVCTCLAAHNGTHCKTRID. 1279
219 9.000e-14gi|730046979|gb|AIZ07946.1| chimeric truncated tPA, partial [synthetic construct]  clstr ali  30  6....CKDEITQMTYRRQESWLRPESKRVEHCQCDRGQARCHTVPVKSCSEPRCFNGGTCQQYFSDFVCQCPEGFAGKCCEIDTRA 90
220 1.000e-13gi|528758000|gb|EPY77659.1| neurogenic locus notch protein 3 precursor-like protein [Camelus ferus]  clstr ali  26  477......DPCHSGPCAGRGVCQSSVARFSCRCPRGFRGPDCSLPDP--CLSSPCAHGARCVSPEGRYVCSCPPGYQGRSCRSDVD. 557
221 1.000e-13gi|926627009|ref|XP_013779062.1| PREDICTED: neurogenic locus Notch protein-like [Limulus polyphemus]  clstr ali  22  29........CSPNPCKNRASCVSRIPVFINSC---YRGINC-DINIDDCPGNLCQHGAKCIDGINSYTCQCPPNYTGPYCSKDVD. 108
222 1.000e-13gi|585652617|ref|XP_006814952.1| PREDICTED: uncharacterized protein LOC102801595 [Saccoglossus kowalevskii]  clstr ali  642.CEIEINECDPDPCQNGGTCTDLIAAYKCNCTDGYNGTNCEIV.......................................... 683
223 1.000e-13gi|584036621|ref|XP_006765598.1| PREDICTED: tissue-type plasminogen activator [Myotis davidii]  clstr ali  25  42....CRDEKTQTTYRHHESWLRLRSNRVEHCWCNSGRPQCHTVPVRGCTEPRCFNGGTCRQYFSNFVCQCPEGFSGQLCEIDARA 126
224 1.000e-13gi|585700002|ref|XP_006897052.1| PREDICTED: tissue-type plasminogen activator [Elephantulus edwardii]  clstr ali  25  38....CRDEKTQTTYQHRQSWLRLRGNRVEYCRCDGGSPQCHSVPVKSCSEPRCFNGGICWQAVYDFVCQCPEGFFGKSCEIDAKA 122
225 1.000e-13gi|620983284|ref|XP_007654537.1| PREDICTED: coagulation factor XII, partial [Ornithorhynchus anatinus]  clstr ali  44  96..EKCFEPQLLRLFPENEMWLRAEPPGVAKCQCQGPQVICKRVPQTKACSTPLVFMGDQFSWEYCKLPSCKPKYTAP........ 173
226 2.000e-13gi|984124736|ref|XP_015354151.1| PREDICTED: delta-like protein 1 [Marmota marmota marmota]  clstr ali  29  36....................QDLENGYSCTCPPGFYGRICELSAMT-CADGPCFNGGRCSDNPGGYTCRCPGGYSGFNCEKKMD. 99
227 2.000e-13gi|591383033|ref|XP_007065980.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 3 [Chelonia mydas]  clstr ali  19  154......DACANNPCANGARCTNWNSRYNCTCPPGYQGRNC-RMDGDE-XPGASLQGHTCCNTPGSFRCQCPAGFTGHLCE..... 225
228 2.000e-13gi|817716253|gb|AKF85454.1| hypothetical protein MFUL124B02_12890 [Myxococcus fulvus 124B02]  clstr ali  279.CEINIDECTPNPCQNGGTCTDGINSYTCTCAPTYEGPNCQS........................................... 319
229 2.000e-13gi|762087863|ref|XP_011426235.1| PREDICTED: uncharacterized protein LOC105327443 [Crassostrea gigas]  clstr ali  22 3521........CESGPCQNGGSCTDGEKGFNCSCTMGFTGRRC-DIQSDPCLQNICQNGATCRNG----TCLCTQQYTGFDC...... 3587
230 2.000e-13gi|405966340|gb|EKC31636.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  22 3514........CESGPCQNGGSCTDGEKGFNCSCTMGFTGRRC-DIQSDPCLQNICQNGATCRNG----TCLCTQQYTGFDC...... 3580
231 2.000e-13gi|765116722|ref|XP_011471889.1| PREDICTED: neurocan core protein [Oryzias latipes]  clstr ali  39 1009.........................................SVENNPCQNNPCLHGGSCLQEGDSYSCYCPQGFSGENCEIDID. 1051
232 2.000e-13gi|831547931|ref|XP_012727125.1| PREDICTED: neurocan core protein isoform X1 [Fundulus heteroclitus]  clstr ali  44 1033.........................................SAESNPCQTSPCLHGGSCLQEGDGYSCYCPQGYSGENCEIDID. 1075
233 2.000e-13gi|808876154|gb|KKF24815.1| Tissue-type plasminogen activator [Larimichthys crocea]  clstr ali  25  38....CVDSETSAVRSFGDTWLRWRGQRVEYCRCSMRGERCHIVPVISCYVSQCYNGGTCKEYTSDYICQCPPGFSGTQCEINTK. 120
234 2.000e-13gi|555979796|ref|XP_005901828.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Bos mutus]  clstr ali  27  42....CRDGKTQMTYRQHDSWLRLRGNQVEHCWCDGGRAQCHSVPVRSCSEPWCFNGGTCRQYSSDFVCQCPEGFMGKLCEIDATA 126
235 2.000e-13gi|679003952|gb|KFW05547.1| Tissue-type plasminogen activator [Fulmarus glacialis]  clstr ali  22  51....CTDNSSGEIYQHRATWLRLSGSRIEYCRCDSGRSRCHTVPVRACTRTKCYNGGQCSQAYYSFICQCHQGFSGKQCEI.... 130
236 3.000e-13gi|780028345|ref|XP_011666333.1| PREDICTED: fibropellin-3-like [Strongylocentrotus purpuratus]  clstr ali  192.CETNINECSSNPCRNDASCIDGVNGFTCSCSPGYTSTRC............................................. 230
237 3.000e-13gi|669302602|gb|KFD46252.1| hypothetical protein M513_12870, partial [Trichuris suis]  clstr ali  37  276.........................AYGCRCRGGLAGLHC-SIDIEECKNNPCRHGGLCMETYGGYTCQCPPGWNGHNCEKDID. 334
238 3.000e-13gi|149023008|gb|EDL79902.1| delta-like 4 (Drosophila) (predicted), isoform CRA_b [Rattus norvegicus]  clstr ali  25  231................GEVCKDHENSYHCLCPPGYYGQHCEHSTLT-CADSPCFNGGSCRNQGASYACECPPNFTGSNCEKKVD. 302
239 4.000e-13gi|929280159|ref|XP_014016949.1| PREDICTED: tissue-type plasminogen activator-like isoform X1 [Salmo salar]  clstr ali  30  62..ERCVDGQSAVVRGVGDTWLRWRGQRVERCTCASRGQRCHYVPVITCYQSRCYNGGTCKEAVYSYLCQCPPGFTGAQCEINTT. 146
240 4.000e-13gi|532039651|ref|XP_005362683.1| PREDICTED: tissue-type plasminogen activator [Microtus ochrogaster]  clstr ali  30  38....CRDEQTQTTYQQDQSWLRLRSNRVEYCRCIGGSAQCHLVPVRSCSEPRCFNGGTCQQYFSDFVCQCPDGFVGKRCDIDTRA 122
241 5.000e-13gi|762092874|ref|XP_011428876.1| PREDICTED: latrophilin-3-like [Crassostrea gigas]  clstr ali  12  458...NNIDDCLPNPCQNNGTCFDLVNDYNCDCMAGFDGTNCERI.......................................... 497
242 5.000e-13gi|731200803|ref|XP_010615416.1| PREDICTED: tissue-type plasminogen activator isoform X10 [Fukomys damarensis]  clstr ali  25  90....CRDEKTQMTYQQHESWLRLRGNRVEFCWCNGGRPQCHSVPIKGCSEPRCFNGGICRQYFSDFVCQCPQGFMGKRCEIGSNA 174
243 6.000e-13gi|780177405|ref|XP_011661540.1| PREDICTED: uncharacterized protein LOC105437059 [Strongylocentrotus purpuratus]  clstr ali  40  478.......................................CQSTDPNECEPNPCLNGGTCTDGVNSFSCTCRAGYYGPICDEGI.. 524
244 7.000e-13gi|675644272|ref|XP_008988424.1| PREDICTED: coagulation factor XII isoform X2 [Callithrix jacchus]  clstr ali  71  133..EKCFEPQLLRFFHQNEIWYRSEQAGVARCRCKGPDAHCQQLASQDTKAS--CYDGRGLSYRG..................... 192
245 9.000e-13gi|465963579|gb|EMP30126.1| Neurogenic locus notch like protein 3, partial [Chelonia mydas]  clstr ali  19  58......DACANNPCANGARCTNWNSRYNCTCPPGYQGRNCRM---DPGAS---LQGHTCCNTPGSFRCQCPAGFTGHLCE..... 125
246 9.000e-13gi|929123077|ref|XP_013979165.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1, partial [Salmo salar]  clstr ali  23  73............PCRNGGSCKEETGSFLCVCPYRFTGKHCEVGRPDPCSSSPCLNGGTCFHYIGKYKCECSGAFSGRHCDI.... 141
247 1.000e-12gi|930236825|ref|XP_014163389.1| PREDICTED: delta-like protein 1 [Geospiza fortis]  clstr ali  22  472......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGSNCEIEI.. 546
248 1.000e-12gi|762125526|ref|XP_011445791.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Crassostrea gigas]  clstr ali  12  462...TEIDECASQPCENNGTCSDGVNMFTCQCPPGYTGSLCE-TDINECADQPCSLLFECEDLINGVSC................. 565
249 1.000e-12gi|974080552|ref|XP_015238031.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Cyprinodon variegatus]  clstr ali  26  38....CVDSETSAVHSFGDSWLRWKGQRVEYCHCPGGRERCHVVPVINCYVSQCYNGGTCKEAVYSYICQCPPGFSGTQCEINT.. 119
250 1.000e-12gi|332241010|ref|XP_003269681.1| PREDICTED: tissue-type plasminogen activator isoform X3 [Nomascus leucogenys]  clstr ali  24  41....CRDEKTQMIYQQHQSWLRLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQYFSDFVCQCPEGFAGKCCEI.... 121
251 2.000e-12gi|156365614|ref|XP_001626739.1| predicted protein [Nematostella vectensis]  clstr ali  23  212..............................CDAGFTGDYCE-INIDECASAPCHSYSTCLDGVNNYTCLCGPRWTGRDCSTN... 262
252 2.000e-12gi|260823778|ref|XP_002606845.1| hypothetical protein BRAFLDRAFT_103547 [Branchiostoma floridae]  clstr ali  235.CEIDIDECESDPCQNGATCLDQVGSYTCVCAPAFSGANCET........................................... 275
253 2.000e-12gi|443090051|dbj|BAM76479.1| protein tyrosine kinase, partial [Ministeria vibrans]  clstr ali  202.CENNIDECASSPCQNAGSCSDAVDMYTCSCAYGFVGNFCENT.......................................... 243
254 2.000e-12gi|850296820|ref|XP_012861334.1| PREDICTED: tissue-type plasminogen activator [Echinops telfairi]  clstr ali  25  42....CRDEKTQMVYQQHESWLRLRSNRVEYCRCNSGRPQCHSVPVKSCSEPRCFSGGLCRQAVYDFVCQCPEGFLGKRCEID... 123
255 2.000e-12gi|634831947|ref|XP_007933213.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Orycteropus afer afer]  clstr ali  24  41....CRDEKTQMTYLQHESWLRLRSNRVEYCWCNSGRPQCHSVPVKHCSEPRCFNGGICWQYFSDFVCQCHEGFVGKRCETDAKA 125
256 3.000e-12gi|260807529|ref|XP_002598561.1| hypothetical protein BRAFLDRAFT_66952 [Branchiostoma floridae]  clstr ali  31  241....................................GVKCAVT--DECASSPCKNGGTCRDGQDRYTCDCPPGWEGVNCDREI.. 285
257 3.000e-12gi|405957080|gb|EKC23316.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  22  232........................................EIVDIDDCNPEPCQNNGTCTDLVNGFQCDCVAGFNGANCENNID. 275
258 3.000e-12gi|972975194|ref|XP_015204449.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Lepisosteus oculatus]  clstr ali  30 1244........CRDLFCHNGGTCMTTPQGPRCHCPLGFAGPDCQRREPAGCAAKPCLQGGSCRDVSSFFQCSCPPGTQGKRCE..... 1317
259 3.000e-12gi|677716695|ref|XP_009082123.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Acanthi  clstr ali  32  560....................................GLKCE-TEVDECKSSPCQNNGICKDGTGTFVCHCQPGYSGLLCEEDI.. 605
260 3.000e-12gi|929485752|ref|XP_014139913.1| PREDICTED: versican core protein [Falco cherrug]  clstr ali  12 3200.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYTGALCEQ........................................... 3243
261 3.000e-12gi|657814251|ref|XP_008334356.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Cynoglossus semilaevis]  clstr ali  28  65....CVDSQRVAVRSYRETWLRWRGQRVEYCRCAGGQERCHIVPVTNCYVSQCYNGGLCKEATSDYICQCPAGFSGNQCEIN... 145
262 4.000e-12gi|584021877|ref|XP_006805601.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Neolamprologus b  clstr ali  28  1...............................MPGFTGAKCE-IDIDECNSAPCQNGGLCKDGIGDFQCQCKPGFLGK........ 45
263 4.000e-12gi|641785124|ref|XP_008174823.1| PREDICTED: neurogenic locus notch homolog protein 2 [Chrysemys picta bellii]  clstr ali  24 1274.....VNTCESQPCQNGGQCKMTVNGYTCRCPPNYSGPNCERS-VLSCRELACFNGGSCQHTALGARCSCLLGFTGPDC...... 1349
264 4.000e-12gi|585194691|ref|XP_006748519.1| PREDICTED: neurogenic locus notch homolog protein 2, partial [Leptonychotes weddellii]  clstr ali  33  1.....................................VNCE-INFDDCASNPCVHG-VCMDGINRYSCVCSPGFTGQRCNIDID. 45
265 4.000e-12gi|939310069|ref|XP_012772836.2| PREDICTED: versican core protein [Maylandia zebra]  clstr ali  29 2613....................................GETMEISGIDSCTEDVCLNGGSCLRIGSTYTCHCAPGFSGHQCEIDID. 2660
266 5.000e-12gi|296482102|tpg|DAA24217.1| TPA: Notch homolog 1, translocation-associated [Bos taurus]  clstr ali  22 1675.CESVINGCKDRPCKNGGSCSNTARGFICKCPAGFEGATCEN-DARSCGSLRCLNGGTCIAGPRSPTCLCLGPFTGPECQ..... 1755
267 5.000e-12gi|973202792|ref|XP_015221289.1| PREDICTED: neurocan core protein [Lepisosteus oculatus]  clstr ali  14 1488.GENCIDDCQSTPCQNGGTCIDEINSFVCLCLPSYGGATCEK........................................... 1531
268 6.000e-12gi|585653738|ref|XP_006815169.1| PREDICTED: fibropellin-1-like, partial [Saccoglossus kowalevskii]  clstr ali  12  241...TDINECASNPCLNNGTCVDGVNSYVCNCVDGYSGDNCQT........................................... 279
269 6.000e-12gi|405964130|gb|EKC29647.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  12  205...TEIDECASQPCENNGTCSDGVNMFTCQCPPGYTGSLCE-TDINECADQPCSLLFECEDLINGVSC................. 308
270 6.000e-12gi|999978878|gb|KXJ18052.1| Fibropellin-1 [Exaiptasia pallida]  clstr ali  717.CENNVDECAKKPCQNGAECIDGVNSYECKCKLGYNGKNCEN........................................... 757
271 6.000e-12gi|972952992|ref|XP_015216137.1| PREDICTED: versican core protein [Lepisosteus oculatus]  clstr ali  32 2673............................................HDSCEDHLCRNGGSCYPRGQSYICTCPPGYSGEHCEIDID. 2712
272 6.000e-12gi|954375478|gb|KRY41416.1| Neurogenic locus notch -like protein 2 [Trichinella spiralis]  clstr ali  38 1405..............................CECRLPGERCENVNYCLEGKNPCNNGGTCVKIENLYKCICPPGYAEPFCRTDYSA 1461
273 7.000e-12gi|470622029|ref|XP_004318964.1| PREDICTED: delta-like protein 1-like [Tursiops truncatus]  clstr ali  22  197......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGANCETEVD. 272
274 7.000e-12gi|292616627|ref|XP_002663097.1| PREDICTED: tissue-type plasminogen activator [Danio rerio]  clstr ali  28  36..EACVDSNSAAVRDIGVTWLRWKGLKVEFCRCALRGARCHEVPVTKCFVSKCYNGGTCKEYSSDFICQCPPGFTGTQCEINT.. 119
275 8.000e-12gi|817301740|ref|XP_012321336.1| PREDICTED: delta-like protein 1 [Aotus nancymaae]  clstr ali  22  420......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGATCELGID. 495
276 8.000e-12gi|564389724|ref|XP_003751671.2| PREDICTED: tissue-type plasminogen activator-like [Rattus norvegicus]  clstr ali  29  38....CRDEQTQTTYQQHQSWLRLRGNRVEYCRCNSGLAQCHSVPVRSCSEPRCFNGGTCQQYFSDFVCQCPDGFVGKRCDIDTRA 122
277 8.000e-12gi|928037192|ref|XP_013867241.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Austrofundulus limnaeus]  clstr ali  25  65....CVDSETSAVRSFGETWLRWKGQRVEYCHCASRGKECHIVPVINCYVSQCYNGGTCKEYSSEYVCQCPPGFSGAHCEIN... 145
278 9.000e-12gi|597733652|ref|XP_007229137.1| PREDICTED: neurogenic locus notch homolog protein 2 [Astyanax mexicanus]  clstr ali  26 1309.............CYNGGSCTVTSRGARCSCQQGFAGPQCQHRSNQSCSSKPCRNNGICIEEANFFSCQCMEGWKGKRCEQE... 1379
279 9.000e-12gi|769242418|ref|WP_044986366.1| hypothetical protein [Sorangium cellulosum]  clstr ali  210.CETDIDECAESPCQNDGTCVDHIDSYSCACLPTYEGTRCE............................................ 249
280 9.000e-12gi|742119511|ref|XP_010874793.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Esox lucius]  clstr ali  28  60...RCVDAQSAAVRGVGETWVRWRGRGMESCRCTSGQERCHSVPVITCYQSRCYNGGTCKEAVYSYLCQCPPGFTGAQCEINTS. 143
281 1.000e-11gi|594106328|ref|XP_006076094.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 1 [Bubalus bubalis]  clstr ali  22  346......DQCIRYPCLHG-TCR---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYTGANCETEVD. 421
282 1.000e-11gi|444728631|gb|ELW69080.1| Delta-like protein 1 [Tupaia chinensis]  clstr ali  22  144......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYTGATCELEVD. 219
283 1.000e-11gi|966648255|gb|KTF83165.1| hypothetical protein cypCar_00027824 [Cyprinus carpio]  clstr ali  34  9....................................GPNCQ-TNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCE..... 51
284 1.000e-11gi|260791940|ref|XP_002590985.1| hypothetical protein BRAFLDRAFT_69464 [Branchiostoma floridae]  clstr ali  185...EDIDECSSAPCQNEATCQDGVNSFTCQCAPGFTGTLCETVPVDGCASQECQNRG............................ 251
285 1.000e-11gi|1005208609|gb|KYF79399.1| hypothetical protein BE18_51545 [Sorangium cellulosum]  clstr ali  11  125.CEIDIDDCAGSPCLNGGTCTDGVNGFTCSCAAGYQGSVCQNL.......................................... 166
286 1.000e-11gi|919071072|ref|XP_013416934.1| PREDICTED: neurogenic locus notch homolog protein 1-like isoform X1 [Lingula anatina]  clstr ali  221.CETDMDECTNNPCKNNGTCVDRVNGFQCTCLVDFTGTTCETTN......................................... 263
287 1.000e-11gi|1020520379|ref|XP_016099578.1| PREDICTED: tissue-type plasminogen activator-like [Sinocyclocheilus grahami]  clstr ali  27  39....CVDANSAAVRDTGATWLRWKGQKVEFCRCVRGRVRCHEIPVTKCFVSKCYNGGTCKEYSNDFICLCPPGFTGTQCEINTA. 121
288 1.000e-11gi|498969091|ref|XP_004547069.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Maylandia zebra]  clstr ali  27  65....CMDSETSAVRSFGDTWLQWKGQRVEYCRCDGGRARCHIVPVINCYVSQCYNGGTCKEYTSDYICQCPRGFTGAQCEINT.. 146
289 1.000e-11gi|657558042|ref|XP_008283120.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Stegastes partitus]  clstr ali  25  66....CVDSETSAVRSYGDTWLRWRGQRVEYCRCALRGERCHVVPVINCYVSQCYNGGTCKEYTSDYICQCPPGFSGTQCEINT.. 147
290 2.000e-11gi|670991327|ref|XP_008686655.1| PREDICTED: delta-like protein 1 isoform X1 [Ursus maritimus]  clstr ali  21  335......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYSGANCETEID. 410
291 2.000e-11gi|808880675|gb|KKF28486.1| Rootletin [Larimichthys crocea]  clstr ali  28 2326.GDKCEEECL---CQNGGVCVDSNG--TCECPSGYTGLYCQF----ECSSRPCPDGGPCLEYGGTYLCTC............... 2391
292 2.000e-11gi|742103139|ref|XP_010869875.1| PREDICTED: neurocan core protein [Esox lucius]  clstr ali  14 1091.GESCIDDCQSNPCQNGGTCIDEINSFVCLCLPSYSGATCEK........................................... 1134
293 3.000e-11gi|260841558|ref|XP_002613979.1| hypothetical protein BRAFLDRAFT_67440 [Branchiostoma floridae]  clstr ali  1429.CELNVNECASSPCLNRAYCEDKINSYLCHCAPGFGGTHCEDGLISE...................................... 1474
294 3.000e-11gi|999976020|gb|KXJ15194.1| Neurogenic locus notch-like protein 2 [Exaiptasia pallida]  clstr ali  16  984...TSVNECQSQPCQNGGKCRDLVGGYKCDCPAKLVGKNCEVLVKDKCLHKDCADGGRCVQKCNNYECN----WDGTTCSLGI.. 1062
295 3.000e-11gi|919042379|ref|XP_013404437.1| PREDICTED: delta-like protein C [Lingula anatina]  clstr ali  90.CENDIDDCKSNPCPNGATCVDRHGHYECVCPAGMAGNLCQHGN......................................... 132
296 3.000e-11gi|971440067|ref|XP_015136072.1| PREDICTED: versican core protein isoform X2 [Gallus gallus]  clstr ali  12 2367.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 2410
297 3.000e-11gi|701304749|ref|XP_010013057.1| PREDICTED: versican core protein-like [Nestor notabilis]  clstr ali  12 1875.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 1918
298 3.000e-11gi|704560924|ref|XP_010182696.1| PREDICTED: versican core protein-like, partial [Mesitornis unicolor]  clstr ali  12 1872.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 1915
299 3.000e-11gi|700438509|ref|XP_009958420.1| PREDICTED: versican core protein-like, partial [Leptosomus discolor]  clstr ali  12 1846.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 1889
300 3.000e-11gi|697493374|ref|XP_009676801.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Struthio camelus australis]  clstr ali  12 3237.GEQCIDECQSNPCRNGATCIDGLNTFTCVCLPSYIGALCEQ........................................... 3280
301 3.000e-11gi|729758935|ref|XP_010576355.1| PREDICTED: versican core protein [Haliaeetus leucocephalus]  clstr ali  12 3265.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYVGALCEQ........................................... 3308
302 3.000e-11gi|727058934|ref|XP_010408162.1| PREDICTED: versican core protein isoform X1 [Corvus cornix cornix]  clstr ali  12 3211.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYVGALCEQ........................................... 3254
303 3.000e-11gi|699586658|ref|XP_009864862.1| PREDICTED: versican core protein-like, partial [Apaloderma vittatum]  clstr ali  12 2993.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYVGALCEQ........................................... 3036
304 3.000e-11gi|727058938|ref|XP_010408164.1| PREDICTED: versican core protein isoform X3 [Corvus cornix cornix]  clstr ali  12 2362.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYVGALCEQ........................................... 2405
305 3.000e-11gi|768373828|ref|XP_011584386.1| PREDICTED: versican core protein isoform X1 [Aquila chrysaetos canadensis]  clstr ali  12 2338.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYVGALCEQ........................................... 2381
306 3.000e-11gi|719755065|ref|XP_010214361.1| PREDICTED: versican core protein-like [Tinamus guttatus]  clstr ali  1884.GEQCIDECQSNPCRNGATCIDGLNTFTCVCLPSYIGTLCEQ........................................... 1927
307 3.000e-11gi|946667246|ref|XP_014431547.1| PREDICTED: hepatocyte growth factor activator [Pelodiscus sinensis]  clstr ali  31  139.TWKCFDDSRYEYFDNGENWTRIYKGIVEECTCVNSRIECQNTRYTSCINNPCLHDSACRMS....................... 199
308 3.000e-11gi|831298177|ref|XP_012680944.1| PREDICTED: tissue-type plasminogen activator [Clupea harengus]  clstr ali  28  16....CVDTQTGAVRGVGEVWMRWRGQQAESCRCNSRGQYCHYVPVITCYVSRCYNGGTCKEAVYSYLCQCPPGFTGSQCEINTS. 98
309 3.000e-11gi|765129385|ref|XP_011477145.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Oryzias latipes]  clstr ali  24  65....CVDSETSAVHGYGDTWLRWKGQRVEYCHCARGQERCHSVPVINCYASQCYNGGTCKEYTSDYICQCPQGFKGAQCEINS.. 146
310 3.000e-11gi|695141325|ref|XP_009513175.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 3-like, partial [Phalacrocorax carbo] :_  clstr ali  33  994......................IHPITGLRCRCPQGGDYCE-TEINLCYSNPCLNGGICTRKEGGYTCICRQHFSGENCEVDSRA 1057
311 4.000e-11gi|1005331906|ref|WP_061615674.1| hypothetical protein [Sorangium cellulosum]  clstr ali  125.CETDIDECAGSPCQNGGTCTDGIDSTTCACLPTYEGTRCE............................................ 164
312 4.000e-11gi|971440063|ref|XP_015136070.1| PREDICTED: versican core protein isoform X1 [Gallus gallus]  clstr ali  12 3294.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 3337
313 4.000e-11gi|694835102|ref|XP_009475037.1| PREDICTED: versican core protein isoform X1 [Nipponia nippon]  clstr ali  12 3286.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 3329
314 4.000e-11gi|998742144|ref|XP_015470576.1| PREDICTED: versican core protein isoform X2 [Parus major]  clstr ali  12 2698.GEQCIDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 2741
315 4.000e-11gi|642123698|emb|CDQ62744.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  28  37...RCVDGQSAAVRGYGDTWMRWRGQRVEYCRCASGRERCHYVPVITCYQSRCYNGGTCKEAVYSFLCQCPPGFTGAQCEINT.. 119
316 5.000e-11gi|795152272|ref|XP_011838799.1| PREDICTED: delta-like protein 1 [Mandrillus leucophaeus]  clstr ali  22  324......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGATCELGID. 399
317 5.000e-11gi|405958724|gb|EKC24823.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Crassostrea gigas]  clstr ali  10  421.CENNIDDCESQPCQNNGTCTDMINDYLCHCTVGFNGRNC............................................. 459
318 6.000e-11gi|731512931|ref|XP_010599639.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 1 [Loxodonta africana]  clstr ali  22  302......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCENGATCTNGQGSYTCSCRPGYTGANCESEID. 377
319 6.000e-11gi|780174542|ref|XP_011661146.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Strongylocentrotus purpuratus]  clstr ali  32  469............................................IDDCSGDPCNNGGTCMDLITGYTCSCPTGFNGTHCET.... 505
320 6.000e-11gi|405974833|gb|EKC39446.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  12  162.CEIDIDECQSSPCQNGGSCNDLVNRFECTCSGRYNGTVCEK----DCRPGP................................. 208
321 6.000e-11gi|732896679|gb|KHJ97042.1| EGF-like domain protein [Oesophagostomum dentatum]  clstr ali  25  223........CEPNPCLNNGICVDRLNHFECSCAEGFAGPKCPEGERCSCSANGCQNGGQCRNS----GCECPTGFTGEFCE..... 294
322 6.000e-11gi|966659267|gb|KTF94121.1| hypothetical protein cypCar_00038132, partial [Cyprinus carpio]  clstr ali  26  89....CVDANSAAVRDIGASWLRWRGQRVEFCRCATRGVRCHEIPVTKCFVSKCYNGGLCKEYSNDFICQCPYGFKGTQCEINTA. 171
323 6.000e-11gi|1007783216|ref|XP_015828615.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Nothobranchius furzeri]  clstr ali  25  63...RCVDSETSAVRSFGDTWMRWKGQRVEFCRCAGGRDVCHVVPVINCYVSQCYNGGTCKEAVYSYICQCPSGFSGAQCEINTS. 146
324 7.000e-11gi|762149167|ref|XP_011412515.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Crassostrea gigas]  clstr ali  15  646.CEINYDECASEPCQNNGTCLDLINGFQCWCPIGFGGIICDTIDQDVCSTDPC................................ 698
325 7.000e-11gi|780073436|ref|XP_011671858.1| PREDICTED: uncharacterized protein LOC105441918, partial [Strongylocentrotus purpuratus]  clstr ali  12  601.CENQTNECDSNPCQNNGTCYDLIDDYNCICVPEYEGKNCEN........................................... 641
326 7.000e-11gi|808860379|gb|KKF12387.1| Neurocan core protein [Larimichthys crocea]  clstr ali  41 1057.........................................SVENNPCQTNPCLHGGSCLQEGDGYSCYCPQGFSGESCEIDID. 1099
327 7.000e-11gi|1020519165|ref|XP_016098932.1| PREDICTED: tissue-type plasminogen activator [Sinocyclocheilus grahami]  clstr ali  24  38....CVDANSATVREIGAAWLRWKGQKVEFCRCAVRRVRCHEIPVTKCFVSKCYNGGTCKEAVYSFICQCPPGFTGTQCEISKSS 121
328 7.000e-11gi|597733817|ref|XP_007229217.1| PREDICTED: tissue-type plasminogen activator [Astyanax mexicanus]  clstr ali  31  50..............ETGETWLRWRGQLVEFCRCPGGTSHCHYTPITTCYKSRCYNGGTCKEASGDFICLCAPGFTGNQCEINLS. 122
329 8.000e-11gi|919028731|ref|XP_013398205.1| PREDICTED: probable G-protein coupled receptor 158, partial [Lingula anatina]  clstr ali  19  227.CETDIDDCAEKPCKNDATCIDLVASYRCICLPGFSGKDCERHDINQCTTNRCQPETTCIPSVGAYKCQCKKGY........... 336
330 9.000e-11gi|765151037|ref|XP_011485919.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Oryzias latipes]  clstr ali  30 3583............PCQNGGVCQ-RPNA--CACQEGWMGRLCEEP-I--CI-LPCLNGGRC---VAPYKCECPAGWTGTRCQTAVCS 3645
331 9.000e-11gi|966647406|gb|KTF82316.1| hypothetical protein cypCar_00020839, partial [Cyprinus carpio]  clstr ali  28  36..EACVDANSAAVRDIGATWLRWKGQKVEFCRCAVRRVRCYEIPVTKCFVSKCYNGGTCKEVLNSFICQCPPGFTGTQCEINTT. 120
332 1.000e-10gi|1003760580|ref|XP_015713415.1| PREDICTED: delta-like protein 1 isoform X1 [Coturnix japonica]  clstr ali  22  299......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGSSCEIEI.. 373
333 1.000e-10gi|909576812|ref|XP_013144200.1| PREDICTED: protein crumbs homolog 2-like [Papilio polytes]  clstr ali  227....NINECENNPCAAGSTCVDGVASYSCVCQDGLTGPNCE-IDIDDCKSQ.................................. 272
334 1.000e-10gi|926612298|ref|XP_013794399.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Limulus polyphem  clstr ali  24 4700............PCLNGGTC---IGPYMCQCRQGFTGSRCERA-I--CEPS-CQNGGKCVEGV----CRCPRIFSGARCE..... 4757
335 1.000e-10gi|831313348|ref|XP_012689199.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Clupea harengus]  clstr ali  29 1118........CESQPCQNGGACSSTASGYTCTCQLGYTGANCERSMSNECSAQPCRNGGLCTEETSFFHCQCPAGFTGKRCE..... 1231
336 1.000e-10gi|499688|gb|AAA29996.1| fibropellin III, partial [Heliocidaris erythrogramma]  clstr ali  237.CEIDINECASLPCQNGATCIDGIDMYTCQCRQGYTGVHCEEV.......................................... 278
337 1.000e-10gi|670614329|gb|KFE60923.1| Coagulation factor XIIa [Hyalangium minutum]  clstr ali  10  247...TNIDECSPNPCLNGGTCTDGVNSFTCACAPTYEGATCQS........................................... 285
338 1.000e-10gi|1011571433|gb|KYO25658.1| neurocan core protein isoform A [Alligator mississippiensis]  clstr ali  14  712.GENCIDDCLSSPCQNGGTCIDEINSFVCLCLPSYGGSLCEK........................................... 755
339 1.000e-10gi|1011571434|gb|KYO25659.1| neurocan core protein isoform B [Alligator mississippiensis]  clstr ali  14  773.GENCIDDCLSSPCQNGGTCIDEINSFVCLCLPSYGGSLCEK........................................... 816
340 1.000e-10gi|970901094|ref|XP_015116283.1| PREDICTED: basement membrane-specific heparan sulfate proteoglycan core protein-like [Diachasma alloeum]  clstr ali  33  209............................YSCTCEYGGINCENVLRQCEMLKPCKHGGTCLEMHGAYKCDCPLGFSGNNCEKQVE. 266
341 1.000e-10gi|617436128|ref|XP_007563499.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Poecilia formosa]  clstr ali  25  65....CVDSETSAVRSFGDTWLRWKGQRVEFCHCALRGEQCHVVPVINCYVSQCYNGGTCKEYSSNYICQCPPGFSGAQCEINT.. 146
342 2.000e-10gi|697844252|ref|XP_009642490.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 1 [Egretta garzetta]  clstr ali  22  147......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGSNCEIEI.. 221
343 2.000e-10gi|667063|emb|CAA35572.1| epidermal growth factor [Strongylocentrotus purpuratus]  clstr ali  73.CETNINECASLPCQNGGLCIDGIAGYTCQCRLGYIGVNCEEV.......................................... 114
344 2.000e-10gi|926504618|ref|XP_013801142.1| PREDICTED: neurogenic locus notch homolog protein 1, partial [Apteryx australis mantelli]  clstr ali  23 1519........CGNLHCLNGGTCISIHKSSKCMCTPAFTGPECQYPASSPCNSNPCYNGGTCEDASPYYRCNCPANFSGLNCHI.... 1594
345 2.000e-10gi|944217864|gb|KQK83413.1| neurogenic locus notch protein 1 [Amazona aestiva]  clstr ali  23 1434........CGNLHCLNGGTCISIHKSSKCMCAPAFTGPECQYPASSPCTSNPCYNGGTCEDASPYYRCNCPANFNGLNCHI.... 1509
346 2.000e-10gi|697840450|ref|XP_009640583.1| PREDICTED: neurogenic locus notch homolog protein 1, partial [Egretta garzetta]  clstr ali  23 1213........CGNLHCLNGGTCISIHKSSKCMCMPAFTGPECQYPASSPCTSNPCYNGGTCEDASPYYRCNCPANFNGLNCHI.... 1288
347 2.000e-10gi|1020415758|ref|XP_016126729.1| PREDICTED: protein crumbs homolog 2-like [Sinocyclocheilus grahami]  clstr ali  1356.CEREVDECASSPCLNGGSCLDRLNHFQCLCPAGFSGQFCET........................................... 1396
348 2.000e-10gi|925683260|gb|KOX79871.1| Neurogenic locus protein delta [Melipona quadrifasciata]  clstr ali  18  471......DQCVRYPCLHG-SCQKP---WECLCDEGWGGLFC-NQDLNYCTNHPCLNGGTCFNTFNGYTCSCAPGFNGTNCE..... 544
349 2.000e-10gi|431918448|gb|ELK17672.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Pteropus alecto]  clstr ali  28 3137............PCLNGGRC---VAPYQCDCPPGWTGSRC-HTAV--CQS-PCLNGGKCV-RPN--RCHCLSAWTGHDC...... 3193
350 2.000e-10gi|676271759|gb|KFO26727.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Fukomys damarensis]  clstr ali  30 3249............PCQNGGVCQ-RPNA--CSCPDGWMGRLCEEP-I--CI-LPCLNGGRC---IAPYQCDCPTGWTGARCHT.... 3307
351 2.000e-10gi|919092834|ref|XP_013383226.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Lingula anatina]  clstr ali  25 4283............PCMHGGTC---VAPYRCTCKPGYTGTRCEKA-I--C-SQPCANGGQCIEPE---ICQCMHGWMPPYCE..... 4340
352 2.000e-10gi|521021885|gb|EPQ03673.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Myotis brandtii]  clstr ali  28 3361............PCLNGGRC---VAPYQCDCPPGWTGSRC-HTAV--CQS-PCLNGGKCV-RPN--RCHCLSAWTGHDC...... 3417
353 2.000e-10gi|260785516|ref|XP_002587807.1| hypothetical protein BRAFLDRAFT_92256 [Branchiostoma floridae]  clstr ali  37 3765..........................................VNFNPCSDSPCQHGGVCVDTGNRYTCSCPTGYTGESCEIEIDA 3832
354 2.000e-10gi|966657499|gb|KTF92353.1| hypothetical protein cypCar_00008339 [Cyprinus carpio]  clstr ali  21  22......DPCYVGYCLNGGECTGIPGSPSCVCPLGFTGQRCEIQKNSTCFPNPCTNGGKCSLLPNDYKCQCARGWTGQHCEQE... 103
355 3.000e-10gi|940775390|ref|XP_014303448.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 1 [Myotis lucifugus]  clstr ali  22  254......DQCIRYPCLHG-TCQ---QPWQCTCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYTGATCEDEVD. 329
356 3.000e-10gi|443089229|dbj|BAM76481.1| protein tyrosine kinase, partial [Ministeria vibrans]  clstr ali  29  839............................................VDECASSPCQNGGTCVDLVDQFTCTCPIEFLGTLCET.... 875
357 3.000e-10gi|507546304|ref|XP_004657113.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Jaculus jaculus]  clstr ali  26 3452............PCLNGGRC---VSPYQCDCPPGWTGSRCHTAT---CQS-PCLNGGKCV-RPN--RCHCLSAWTGHDC...... 3508
358 3.000e-10gi|927172521|ref|XP_013923191.1| PREDICTED: hepatocyte growth factor activator, partial [Thamnophis sirtalis]  clstr ali  29  92...KCFDETLSEYFEPGDRWARIYQGSIQGCSCVNSTANCHPEMYTGCPSDPCLPRGTCRRTSDRTICLCNHLFRGRHCNV.... 173
359 4.000e-10gi|208972117|gb|ACI32657.1| Delta protein [Periplaneta americana]  clstr ali  23  262......DECERYPCLHG-TCQKPWD---CLCDEGWGGLFC-NQDLNYCTNHPCRHGGTCFNGQGSYTCSCPPGYTGTDCERELD. 337
360 4.000e-10gi|16923547|gb|AAL31528.1|AF426384_1 deltaD protein [Danio rerio]  clstr ali  21  253......DDCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCQNGATCTNGQGSYTCSCRPGFTGDSCEIEV.. 327
361 4.000e-10gi|762091652|ref|XP_011428230.1| PREDICTED: matrilin-2-like [Crassostrea gigas]  clstr ali  28  482.............................................DSCKSSPCENGGTCVDQLTGFTCNCITGFDGNRCQNNID. 520
362 4.000e-10gi|405951848|gb|EKC19723.1| Fibropellin-1, partial [Crassostrea gigas]  clstr ali  10 1059.CENNVDECITQPCMNNGTCIDLISDYKCVCLGGFNGTNC............................................. 1097
363 4.000e-10gi|907632923|ref|XP_013099113.1| PREDICTED: protein crumbs isoform X7 [Stomoxys calcitrans]  clstr ali  17 1051..EINIDECRYSPCGDHGTCIDQVNDYECDCDAMYGGKNC-SVPLIGCLSAPCSNGGICKPYVNEFNCSCQHGFQGYTCE..... 1133
364 4.000e-10gi|831303676|ref|XP_012683947.1| PREDICTED: versican core protein-like [Clupea harengus]  clstr ali  11  471GGELCIDECHSNPCLNGGTCVDGLNSYTCVCLPSYAGTLCEE........................................... 515
365 5.000e-10gi|12057020|emb|CAC19873.1| putative notch receptor protein [Branchiostoma floridae]  clstr ali  24  21...........SPCLNGGVCTDSVTRQTCICRDGWVGEYCQ--EVDPCASNPCRHGGTCVVHDNAWSCDCPLGYTDVICLTVVD. 94
366 5.000e-10gi|405957079|gb|EKC23315.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  25  88.....................................KTCTDRNTDDCRAEPCQNNGTCTDLFNDYQCDCVAGFNGTNCENNID. 134
367 5.000e-10gi|919076481|ref|XP_013419329.1| PREDICTED: neurotrypsin-like [Lingula anatina]  clstr ali  30  25............................................VDQCLSNPCLNLGTCTDGDNQFSCSCVAGFAGIRCEINI.. 63
368 5.000e-10gi|443089673|dbj|BAM76480.1| protein tyrosine kinase, partial [Ministeria vibrans]  clstr ali  450...ENIDECDSSPCQNGGVCHDGINSHTCDCPYGFLGLLCEQ........................................... 488
369 5.000e-10gi|733900819|ref|XP_010714209.1| PREDICTED: neurogenic locus notch homolog protein 2 [Meleagris gallopavo]  clstr ali  21  812.CESVIDVCPRKPCQNGGTCSNMPDGFICQCPPGYSGAKCERLAVGECASAPCQNGGSCHSQPPYYYCQCPDHAQGSQCEQLI.. 935
370 5.000e-10gi|699244344|ref|XP_009859133.1| PREDICTED: uncharacterized protein LOC104265851 [Ciona intestinalis]  clstr ali  477.CEINIDDCASGPCLNGGTCVDEVNAFRCLCHDGHQGIFCNNT.......................................... 518
371 5.000e-10gi|537228073|gb|ERE83520.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  26 3579............PCLNGGRC---VAPYQCDCPAGWTGSRCHTAT---CQS-PCLNGGKCI-RPN--RCHCLSAWTGHDC...... 3635
372 6.000e-10gi|821467282|ref|XP_012397806.1| PREDICTED: neurogenic locus notch homolog protein 3 [Sarcophilus harrisii]  clstr ali  26  993.......PCESQPCQHGGQCQPSPNSYTCHCPPPFWGSSCERVAR-SCRDLPCANGGLCQLTALGPRCTCPPGLAGPSC...... 1066
373 6.000e-10gi|148227866|ref|NP_001081074.1| neurogenic locus notch homolog protein 1 precursor [Xenopus laevis]  clstr ali  23 1351........CSNLRCQNGGTCISVLTSSKCVCSEGYTGATCQYPVISPCASHPCYNGGTCQAEEPFFQCFCPKNFNGLFCHI.... 1425
374 6.000e-10gi|321466601|gb|EFX77596.1| hypothetical protein DAPPUDRAFT_30003, partial [Daphnia pulex]  clstr ali  38 1064..........................................LEVNECFSLPCQNGGQCRTLDFGYVCDCPAGYTGMQCQTDVD. 1105
375 6.000e-10gi|537217922|gb|ERE82153.1| delta-like protein 1 [Cricetulus griseus]  clstr ali  22  271......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYTGANCELEVD. 346
376 7.000e-10gi|260833680|ref|XP_002611840.1| hypothetical protein BRAFLDRAFT_123361 [Branchiostoma floridae]  clstr ali  761.CELNVDDCADKPCQNEGTCEDLVNGFKCTCPKGITGDLCERT.......................................... 802
377 7.000e-10gi|1004679913|ref|XP_015744055.1| PREDICTED: delta-like protein 3 [Python bivittatus]  clstr ali  22  273......DECVRYPCLHG----TRLQPWQCNCQEGWGGLFC-NQDLNYCTNHPCQNGAACTNGQGGYTCTCPPGFVGTSCEVEI.. 347
378 7.000e-10gi|585717697|ref|XP_006825741.1| PREDICTED: neurogenic locus Notch protein-like [Saccoglossus kowalevskii]  clstr ali  35  55.......................................NEEQDINDCEPNPCQNGGVCTDGVNMFSCNCPDGYQGSLCGGDTD. 99
379 7.000e-10gi|1008751216|ref|XP_015851188.1| PREDICTED: coagulation factor XII isoform X2 [Peromyscus maniculatus bairdii]  clstr ali  52  135..EKCFEPQLLRFFHEDEVWFRAGSEGLARCQCKGSGPHCKPLASQDIKAT--CYEGNGLSYRGK.................... 195
380 8.000e-10gi|780142112|ref|XP_011680804.1| PREDICTED: low-density lipoprotein receptor-related protein 2-like [Strongylocentrotus purpuratus]  clstr ali  28  290.....IDVCANR-CLNNGSCVRSLTSVKCSCPFGFLGSRCE---IDAC-TNRCVNGGTCAPSERGSICICPEGFSGSKC...... 358
381 9.000e-10gi|938053521|gb|KPP59740.1| delta-like protein D precursor-like [Scleropages formosus]  clstr ali  21  253......DDCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCMNGATCTNGQGSYTCSCRPGFTGASCEIEV.. 327
382 9.000e-10gi|884984362|ref|XP_012988383.1| PREDICTED: neurogenic locus notch homolog protein 1-like isoform X2 [Esox lucius]  clstr ali  20 1314........CGSLSCRNGGTCVSGHLSPRCLCTAAFTGPECHTPTDSPCNTNPCYNGGTCQSTTDSFHCSCPTNFNGLLCHI.... 1388
383 1.000e-09gi|973188311|ref|XP_006638525.2| PREDICTED: delta-like protein 1 [Lepisosteus oculatus]  clstr ali  21  256......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCMNGATCTNGQGSYTCSCKPGFTGASCEIEV.. 330
384 1.000e-09gi|884960194|ref|XP_012991443.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 2-like [Esox lucius]  clstr ali  26 1270........CESQPCQNGGACSVSSSSYVCTCQLGYAGNQCERSMS--CRELSCYNGGSCGLTTRGARCTCPPGFTGSQCQ..... 1342
385 1.000e-09gi|759097815|ref|XP_011366975.1| PREDICTED: neurogenic locus notch homolog protein 2 [Pteropus vampyrus]  clstr ali  20  848.....VNLCSRSPCKNKGTCIQEKAESWCLCPSGWAGAYCDVPNV-SCAARLCQHAGVCINAGNSHHCQCPAGYTGSYCEQQLD. 935
386 1.000e-09gi|780119218|ref|XP_011677661.1| PREDICTED: fibropellin-1 [Strongylocentrotus purpuratus]  clstr ali  409...TDINDCSPDPCENGGTCIDGVDTFTCACAPGYIGPTC............................................. 445
387 1.000e-09gi|505768687|ref|XP_004600512.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Sorex araneus]  clstr ali  30 3478............PCQNGGICQ-RPNA--CSCPEGWMGRLCEEP-I--CI-LPCLNGGRC---VAPYQCECTAGWTGARCHT.... 3536
388 1.000e-09gi|537228072|gb|ERE83519.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  26 3310............PCLNGGRC---VAPYQCDCPAGWTGSRCHTAT---CQS-PCLNGGKCI-RPN--RCHCLSAWTGHDC...... 3366
389 1.000e-09gi|884984360|ref|XP_012988382.1| PREDICTED: neurogenic locus notch homolog protein 1-like isoform X1 [Esox lucius]  clstr ali  20 1352........CGSLSCRNGGTCVSGHLSPRCLCTAAFTGPECHTPTDSPCNTNPCYNGGTCQSTTDSFHCSCPTNFNGLLCHI.... 1426
390 1.000e-09gi|351714659|gb|EHB17578.1| Delta-like protein 1 [Heterocephalus glaber]  clstr ali  23  256......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYTGANCELETD. 331
391 1.000e-09gi|157167660|ref|XP_001661628.1| AAEL011396-PA [Aedes aegypti]  clstr ali  21  252......DECEPYPCIHG-TCKK---PWECLCNEGWGGLFC-NQDLNFCTNHPCQNGGTCFNGQGSYTCQCPPGYIGTDCETRI.. 326
392 1.000e-09gi|808885744|gb|KKF32445.1| Delta-like protein 4 [Larimichthys crocea]  clstr ali  22  256......DVCKIHPCKHG-TCTE---PWQCICKEGWGGIYC-DQDLNYCTHNPCTNGATCMNGEGSYTCTCLPGFTGVNCDLEV.. 330
393 1.000e-09gi|954351159|gb|KRY23813.1| Neurogenic locus notch -like protein 3 [Trichinella patagoniensis]  clstr ali  38  259..............................CLCKSPGTYCKDVNYCLEGKNPCNNGGTCVKIENLYKCICPPGYAEPFCRTDYS. 314
394 1.000e-09gi|47219678|emb|CAG12600.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  36  104................GECVVNLKQHPYYECKCKPPGPNCMSLPSSPCEPNPCKNGGSCIRGDRRFHCACPDGYTGKLCET.... 170
395 2.000e-09gi|938071161|gb|KPP69595.1| neurogenic locus notch protein-like [Scleropages formosus]  clstr ali  21 1522........CGSLHCRNGGTCISGHKSPSCLCTVAFTGPECQYLVDSPCNSNPCYNGGTCVSEDHLYHCVCPTNFNGLLCHI.... 1596
396 2.000e-09gi|363895250|gb|AEW42991.1| notch [Nematostella vectensis]  clstr ali  16  918.CEESINECLSQPCKNGGSCRDIVNGYKCDCPSKMIGKNCETVVKDQCPVPNCADGGKCNPKCNTHECN----WDGTTCSLGI.. 998
397 2.000e-09gi|597766523|ref|XP_007247138.1| PREDICTED: protein crumbs homolog 1-like [Astyanax mexicanus]  clstr ali  1258.CEIEINECMSNPCLNGGTCLDRLSFFQCVCAAGFSGPYCET........................................... 1298
398 2.000e-09gi|565319726|gb|ETE70770.1| Neurogenic locus notch-like protein 3, partial [Ophiophagus hannah]  clstr ali  26 1259.............CFNGGSCRASLLGAHCYCLPGWTGPDCRLRANSSCANQPCHNGGVCHETPPYFQCLCPGDYTGVRCQT.... 1328
399 2.000e-09gi|556971500|ref|XP_005994132.1| PREDICTED: neurogenic locus notch homolog protein 2 [Latimeria chalumnae]  clstr ali  23  32............PCVNEGRCINNGSGY-CQCAEGYLGDYCQYKDP--CQRKPCQNGGTCTDGVATTHCQCPLDYTGESCE..... 102
400 2.000e-09gi|675427937|ref|XP_008927860.1| PREDICTED: neurogenic locus notch homolog protein 2 [Manacus vitellinus]  clstr ali  22  100..........SKPCVNEGKCISYQNGY-CKCREGFLGDYCQYRNP--CESNTCKNGGTCESLIGKPTCKCAPGFTGEDCQ..... 170
401 2.000e-09gi|612000483|ref|XP_007485365.1| PREDICTED: neurogenic locus notch homolog protein 2 isoform X2 [Monodelphis domestica]  clstr ali  21 1263.CETFLDVCPQMPCLNGGVCSNMPNGFICHCPPGFSGARCQSTEDCECASGPCRHGGSCQKEPPYYACRCPPSFWGSHCE..... 1374
402 2.000e-09gi|966702582|gb|KTG34823.1| hypothetical protein cypCar_00018775 [Cyprinus carpio]  clstr ali  22  652......DTCKVEPCLNGGECKVTWNDFTCSCSRDFTGKTCETLVW--CVSDPCVNGGRCLELLDGFECI................ 712
403 2.000e-09gi|260790079|ref|XP_002590071.1| hypothetical protein BRAFLDRAFT_123438 [Branchiostoma floridae]  clstr ali  12  539....NVDDCADKPCMNGGTCLDRVNGYVCRCPEGYGGHNCHRRD......................................... 578
404 2.000e-09gi|919002689|ref|XP_013413657.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Lingula anatina]  clstr ali  943.CETNINECASSPCVNGATCHDDVNKFICKCKPYYSGKTC............................................. 981
405 2.000e-09gi|635062167|ref|XP_007965154.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X6 [Chlorocebus sabaeus]  clstr ali  28  802.....VDACDSSPCQHGGRCESGGGAYLCVCPEGFFGYHCE-TASDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGKDC...... 874
406 2.000e-09gi|926637784|ref|XP_013784884.1| PREDICTED: EGF, latrophilin seven transmembrane domain-containing protein 1-like [Limulus polyphemus]  clstr ali  22  165.....FDLCSWNPCENFGICRPTNKSYTCECPIGFSGQNCTVFNPCALRPSPCENGASCQSSASHFTCACAPGFYGRTC...... 240
407 3.000e-09gi|241576133|ref|XP_002403554.1| LIN-12 protein, putative [Ixodes scapularis]  clstr ali  23  42.............CQNGGTCNVEMSSFSCTCPVGYSASMCEIAVPSACDDRPCRNGGTCLVTLDNYTCACATGFRGKHCD..... 114
408 3.000e-09gi|663265211|ref|XP_008493114.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 2 [Calypte anna]  clstr ali  19 1155.CESVIDVCPRKPCQNGGTCSNMPDGFICQCPPGYSGAKCEQTNTG-CASAPCQNGGSCHSQPPYYYCQCPVHTQGSQCEQPV.. 1278
409 3.000e-09gi|1019005115|ref|XP_016080882.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1-like [Ornithorhynchus anatinus]  clstr ali  21 1347.CENDARTCGSLHCQNGGTCVSGHKSSKCLCLPPYTGPECQYPVSSPCLSNPCYNQGTCEFTPEAYRCHCPAKFNGLYCHI.... 1428
410 3.000e-09gi|919038824|ref|XP_013402901.1| PREDICTED: fibrillin-1-like [Lingula anatina]  clstr ali  37  391...........................................DNDECVSNPCQNGGKCNNLYNRFECTCAVGTTGTRCETDV.. 430
411 3.000e-09gi|620948150|ref|XP_007653845.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ornithorhynchus anati  clstr ali  26 3602............PCLNGGRC---VAPYRCDCPAGWTGSRC-HTAV--CQS-PCLNGGKCV-RPN--RCYCLSAWTGHDC...... 3658
412 3.000e-09gi|826284669|ref|XP_012496583.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Propithecus coquereli  clstr ali  39 1004..............................................ECFLNPCHNGGTCQQLGRGYVCVCLPGYTGLKCEIDID. 1041
413 3.000e-09gi|432091556|gb|ELK24581.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Myotis davidii]  clstr ali  28 3282............PCLNSGRC---VAPYQCDCPPGWTGSRC-HTAV--CQS-PCLNGGKCV-RPN--RCHCLSAWTGHDC...... 3338
414 3.000e-09gi|585643771|ref|XP_006811418.1| PREDICTED: mucin-2-like, partial [Saccoglossus kowalevskii]  clstr ali  43  12...............................................CRLNPCLNGGTCNDYIDYYTCDCYPGWTGYDCEADVD. 48
415 3.000e-09gi|795231173|ref|XP_011896885.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X4 [Cercocebus atys]  clstr ali  28  723.....VDACDSSPCQHGGRCESGGGAYLCVCPEGFFGYHCE-TASDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGKDC...... 795
416 4.000e-09gi|831325534|ref|XP_012695845.1| PREDICTED: delta-like protein 1 [Clupea harengus]  clstr ali  21  256......DDCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCMNGATCTNGQGSYTCTCKPGFSGENCEVEV.. 330
417 4.000e-09gi|597780625|ref|XP_007253900.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Astyanax mexicanus]  clstr ali  20 1351........CGSLQCKNGGTCVSGHKNPRCLCSPSFTGPECQYPSDGPCLSNPCYNGGTCEPSTESFHCVCPADFNGLLCHI.... 1425
418 4.000e-09gi|998706760|ref|XP_015491099.1| PREDICTED: neurogenic locus notch homolog protein 2 [Parus major]  clstr ali  22  17..........SKPCVNEGKCIPYQNGY-CKCREGFLGDYCQYRNP--CESNTCKNGGTCESLIGKPTCRCAPGFTGEECQ..... 87
419 4.000e-09gi|620960304|ref|XP_007664966.1| PREDICTED: neurogenic locus notch homolog protein 2 [Ornithorhynchus anatinus]  clstr ali  25  98............PCINEGKCVTYHNGY-CKCPEGFLGDYCQHRDP--CKSNRCQHGGTCVALQGKAVCQCAPGFTGENCQ..... 166
420 5.000e-09gi|852784274|ref|XP_012883732.1| PREDICTED: neurogenic locus notch homolog protein 3 [Dipodomys ordii]  clstr ali  22 1274.CEADINECRPGVCHHTRDCQDPGGHFRCLCHPGFTGPRCQTV-LSPCEAQPCQHGGQCRASPATFTCHCVQPFWGPRCE..... 1359
421 5.000e-09gi|675846298|ref|XP_009008709.1| hypothetical protein HELRODRAFT_158374 [Helobdella robusta]  clstr ali  15  350....DLDECLSNPCLNNATCIDHEAHYKCNCQPSYGGTNCEN........................................... 387
422 5.000e-09gi|602638797|ref|XP_007426223.1| PREDICTED: neurogenic locus notch homolog protein 2 isoform X1 [Python bivittatus]  clstr ali  24 1322........CRELFCFNGGSCRTSALGAHCYCLPGWAGPDCRLRANSSCASLPCQNGGACHEITTYFQCLCLGDYTGVRCQT.... 1396
423 5.000e-09gi|734635905|ref|XP_010746565.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Larimichthys crocea]  clstr ali  39 1210..............................................ECFLNPCQNKGTCEEVGAGYVCTCMPGFTGAKCEIDID. 1247
424 5.000e-09gi|699698459|ref|XP_009890633.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Charadrius vociferus]  clstr ali  27  44.............CLNGGKCETFLNGTVCQRQDGFASKTCQQADP--CASNPCANGGQCVPFEAHYICRCTAGFHGANCKQDV.. 112
425 5.000e-09gi|852787419|ref|XP_012884825.1| PREDICTED: neurogenic locus notch homolog protein 1 [Dipodomys ordii]  clstr ali  21  290..........SQPCLNGGKCEVVNGTEACVCGGAFVGQRCQ--DPNPCLSTPCKNSGTCVDRGGDYACSCPLGFSGPLCLTPLD. 368
426 5.000e-09gi|532088208|ref|XP_005329812.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ictidomys tridecemlin  clstr ali  39 1194..............................................ECFLNPCHNSGTCQQLGHGYVCLCPPGYTGLKCETDID. 1231
427 5.000e-09gi|765158366|ref|XP_011488883.1| PREDICTED: delta-like protein 4 [Oryzias latipes]  clstr ali  27  301.......ECDSKPCYNGGRCLESENGYRCVCANGFEGPQCEHRMLT-CTDKPCFHGGKCRERGNGYLCECPAGYTGLNCE..... 374
428 5.000e-09gi|926644402|ref|XP_013788467.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Limulus polyphem  clstr ali  17  402........CASSPCQNGATCFDLKDDFQCCCPKGFTGKLCEK-PINKCEDLPCKNGATCVSTLEGFECKCKKGFEGTVCQVNID. 476
429 5.000e-09gi|961901797|ref|XP_014903321.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Poecilia latipinna]  clstr ali  24  38....CVDSETSAVRSFGDTWLRWKGQRVEFCHCALRGEQCHVVPVINCYVSQCYNGGTCKEYSSNYICQCPPGFSGAQCEI.... 117
430 5.000e-09gi|936703917|ref|XP_014229922.1| PREDICTED: neural-cadherin [Trichogramma pretiosum]  clstr ali  29 2788....CQDP-----FECVDLW------NVYECTCGEGRIKSPDNKGCECIDYPCLNGGRCINQDPRYRCICPDGFWGENCEL.... 2859
431 6.000e-09gi|943952672|ref|XP_014359206.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus Notch protein-like [Papilio machaon]  clstr ali  21  42........CSPSPCKNSGTCLSTPGEYFCNCTSRYAGEFCQHLNPCHSESSPCQNGGTCRVRPGSFACDCPLGFSASLCEIRV.. 124
432 6.000e-09gi|657554292|ref|XP_008281602.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Stegastes partitus] :  clstr ali  39 1211..............................................ECFLNPCQNKGTCEEVGAGYVCTCMPGFTGAKCEIDID. 1248
433 6.000e-09gi|470618392|ref|XP_004317818.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Tursiop  clstr ali  42 1175..............................................ECFLNPCHNGGTCQQLGRGYVCLCPTGYTGLKCETDID. 1212
434 6.000e-09gi|542219065|ref|XP_003439666.2| PREDICTED: versican core protein-like [Oreochromis niloticus]  clstr ali  35 1093..........................................INITDCSTNVCQNGGSCYKKGPQNVCICAPGYTGWHCETDID. 1137
435 6.000e-09gi|954485031|gb|KRZ14739.1| Protocadherin Fat 1 [Trichinella zimbabwensis]  clstr ali  35  102.....................KSDNLTHYSCECRMPGKRCERINYCLTDENPCNNGGTCIKVNDLYNCICPPGYAGIFCRTDYAA 167
436 7.000e-09gi|975124762|ref|XP_015278090.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 3 [Gekko japonicus]  clstr ali  22 1282........CREFFCFNSGSCRTTQLGARCFCPPGWAGPDCRLRANSSCASFPCHNGAACHDRPPYFQCICSDDFTGSRCQ..... 1355
437 7.000e-09gi|847092916|ref|XP_012808841.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Xenopus tr  clstr ali  30 3593............PCQNGGVCE-RPNA--CSCPKGWMGRLCEEP-I--C-PLPCLNGGRCT---APFRCECPNGWTGSRCHI.... 3651
438 7.000e-09gi|847092922|ref|XP_012808851.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X3 [Xenopus tr  clstr ali  30 3528............PCQNGGVCE-RPNA--CSCPKGWMGRLCEEP-I--C-PLPCLNGGRCT---APFRCECPNGWTGSRCHI.... 3586
439 7.000e-09gi|808860518|gb|KKF12512.1| Delta-like protein 4 [Larimichthys crocea]  clstr ali  20  170......DECRKYPCKHG-TCQ---LPWQCNCQEGWGGLLC-DQDLNFCTHHPCVNGATCMNGQGSYTCTCLPGFTGVNCELE... 243
440 7.000e-09gi|593721958|ref|XP_007107208.1| PREDICTED: delta-like protein 1, partial [Physeter catodon]  clstr ali  22  200......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGANCETEVD. 275
441 7.000e-09gi|669327331|gb|KFD67533.1| hypothetical protein M514_20210 [Trichuris suis]  clstr ali  19  938..EKDENDCESNPCVNG-WCVDLVGGYKCICRRGMEGDDCCEIEMDRCMSSPCSEAATCVDLKNGYICICPEGYKGVHCQ..... 1052
442 7.000e-09gi|1020598834|ref|XP_016117636.1| PREDICTED: EGF-like repeat and discoidin I-like domain-containing protein 3, partial [Sinocyclocheilus grahami]  clstr ali  35  39........................NEYVCKCQPGFEGAHCH-INVNDCANQPCKNGGLCRDLDGDYTCHCPSPYVGKQCQL.... 94
443 8.000e-09gi|529164916|gb|AGS58246.1| neurogenic locus notch-like protein 1, partial [Clarias batrachus]  clstr ali  22  891........CGPLRCRHGATCLPGP---RCLCPPGYSGRECQTRLDSPCASNPCYNGGTCQTSAEAFHCLCPSHFNGVFCHI.... 962
444 8.000e-09gi|742180473|ref|XP_010887980.1| PREDICTED: protein crumbs homolog 2-like [Esox lucius]  clstr ali  19  977......DACQAEPCHNSGECSVTWNDFECSCTAAFTGKTCDRRVW--CVSDPCVNGGQCVDLTDGYECV................ 1037
445 8.000e-09gi|966657413|gb|KTF92267.1| hypothetical protein cypCar_00021979 [Cyprinus carpio]  clstr ali  26 1317.............CYNGGSCSLTSRGARCTCIQGFGGPLCQHRSNEGCSSKPCRNGGLCTEETSFFHCQCINGWTGNRCEQE... 1387
446 8.000e-09gi|1007721883|ref|XP_015802265.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Nothobran  clstr ali  29 3521.............CHNGGVCQ-RPN--ICACPEGWMGRLCEEP-I--CI-LPCLNGGRC---VAPYQCECPTGWTGTRCHTAVCS 3582
447 8.000e-09gi|119310172|ref|NP_571377.2| neurogenic locus notch homolog protein 1 precursor [Danio rerio]  clstr ali  24 1329........CGSLQCKNGGTCVSGHKSPKCLCTPAFTGPECQDPSGGHCTTNPCYNGGTCITEEPYYHCICPTNFNGLFCHI.... 1403
448 8.000e-09gi|564305384|ref|XP_006225372.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Rattus nor  clstr ali  39 1332..............................................ECFLNPCHNSGTCQQLGRGYVCLCPPGYTGLKCETDID. 1369
449 8.000e-09gi|664738434|ref|XP_008526507.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 1 [Equus przewalskii]  clstr ali  22  245......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGANCQTEID. 320
450 9.000e-09gi|507672269|ref|XP_004638163.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Octodon degus]  clstr ali  29 3451............PCLNGGRC---VAPYQCDCPHGWTGARCHTAT---CQ-FPCLNGGKCV-RPN--RCHCPSAWTGHDC...... 3507
451 1.000e-08gi|725601048|ref|XP_010350538.1| PREDICTED: neurogenic locus notch homolog protein 1 [Saimiri boliviensis boliviensis]  clstr ali  22  78.............CLNGGKCEAANGTEACACSGAFVGLRCQ--DSNPCLSTPCKNAGTCVDGVADYVCSCPLGFSGPLCLTPLD. 150
452 1.000e-08gi|929758159|ref|XP_014154061.1| hypothetical protein SARC_07472 [Sphaeroforma arctica JP610]  clstr ali  24 1043......NYCSPDPCNGNGNCVNPSVGFECVCFSGYSGTNCEVVPPLTCSSNPCFYGGFCLDRIYGVKCICVGGRTGEFCQNDV.. 1122
453 1.000e-08gi|974065199|ref|XP_015229971.1| PREDICTED: protein eyes shut homolog [Cyprinodon variegatus]  clstr ali  26  823........CQHLPCRNGGTCVSDAEDWFCECPPLYTGRLCQLSA---CERGPCRHGATCIEVV----CLCPFGRQGLLCDQTI.. 895
454 1.000e-08gi|910327343|ref|XP_013166846.1| PREDICTED: neurogenic locus Notch protein [Papilio xuthus]  clstr ali  21  42........CSPSPCKNSGTCLSTPGEYFCNCTSRYAGEFCQHLNPCHSESSPCQNGGTCRVRPGSFACDCPLGFSASLCEIRV.. 124
455 1.000e-08gi|410930456|ref|XP_003978614.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Takifugu rubripes] :_  clstr ali  42 1199..............................................ECFLNPCQNKGTCEEVGAGYICTCMPGFTGAKCEVDID. 1236
456 1.000e-08gi|657737087|ref|XP_008321496.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cynoglossus semilaevi  clstr ali  42 1219..............................................ECFLNPCQNKGTCEEVGAGYICTCMPGFTGAKCEVDID. 1256
457 1.000e-08gi|966671475|gb|KTG04856.1| hypothetical protein cypCar_00010133 [Cyprinus carpio]  clstr ali  22 1299.CENDAHACGTLQCKNGGTCVSGHKSPKCLCTPAFTGPECQHPTEGHCTTNPCYNGGTCISEAPYYHCICPTSFNGLFCHI.... 1380
458 1.000e-08gi|617436798|ref|XP_007563718.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Poecilia f  clstr ali  25 3533.............CQNGGVCQ-RPN--ICACPEGWMGRLCEEP-I--CI-LPCLNGGHC---VAPYQCECPSGWTGTRCHTAVCS 3594
459 1.000e-08gi|1009530901|ref|XP_015930812.1| PREDICTED: protein crumbs-like, partial [Parasteatoda tepidariorum]  clstr ali  19  4.............CQHG-DCHNEEPGYHCDCKQGYYGDVCDKFNP--CSLEPCENFGKCQNSSNKYRCECLPGFSGQNC...... 69
460 1.000e-08gi|807696|gb|AAC38017.1| x-Delta-1 [Xenopus laevis]  clstr ali  22  257......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCENGATCTNGQGSYTCSCRPGYTGSNCEIEV.. 331
461 1.000e-08gi|505847732|ref|XP_004617329.1| PREDICTED: delta-like protein 1, partial [Sorex araneus]  clstr ali  22  243......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCQPGYTGATCETEVD. 318
462 1.000e-08gi|831302905|ref|XP_012683523.1| PREDICTED: delta-like protein C [Clupea harengus]  clstr ali  20  237......DECIRYPCVHG-TC---GQPWQCNCKEGWGGLFC-DQDLNFCTNHPCMNGATCTNGQGSYTCTCQKGFTGERCEIEI.. 311
463 1.000e-08gi|961000489|ref|XP_014816003.1| PREDICTED: versican core protein isoform X2 [Calidris pugnax]  clstr ali  12  518.GEQCVDECQSNPCRNGATCIDGLNTFTCLCLPSYIGALCEQ........................................... 561
464 1.000e-08gi|584005006|ref|XP_006797502.1| PREDICTED: versican core protein-like [Neolamprologus brichardi]  clstr ali  35  928..........................................INITDCSTNVCQNGGSCYKKGPQNVCICAPGYTGWHCETDID. 972
465 1.000e-08gi|947258585|ref|XP_014444999.1| PREDICTED: hepatocyte growth factor activator isoform X3 [Tupaia chinensis]  clstr ali  28  193GTEKCFDETRSEYLEVGDRWARVHQGRVEQCSCTEGQARCEDTRHT....................................... 238
466 1.000e-08gi|507986261|ref|XP_004695901.1| PREDICTED: coagulation factor XII-like, partial [Condylura cristata]  clstr ali  65  1...............................................CHTNPCLNGARCLEAEGHRLCQCPSDYAGSLCEVDLKA 38
467 2.000e-08gi|632977422|ref|XP_007905334.1| PREDICTED: neurogenic locus notch homolog protein 3 [Callorhinchus milii]  clstr ali  23 1272.............CQSNELCLDSPLGAQCTCLPGFTGPACHLRNNNTCAGRPCRNGGFCKRQPPYYQCLCPKEFGGSRCEL.... 1341
468 2.000e-08gi|597767122|ref|XP_007247422.1| PREDICTED: delta-like protein 1 [Astyanax mexicanus]  clstr ali  21  258......DDCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCENGATCTNGQGSYTCACRPGFTGASCEIEV.. 332
469 2.000e-08gi|836709485|ref|XP_004613460.2| PREDICTED: neurogenic locus notch homolog protein 1 [Sorex araneus]  clstr ali  22  183.............CLNGGKCQVAANGTECVCSSAFTGPRCQ--DPNPCLSAPCRNGGTCHAGALAYACSCRLGFSGPLC...... 251
470 2.000e-08gi|557326919|ref|XP_006036429.1| PREDICTED: neurogenic locus notch homolog protein 2 [Alligator sinensis]  clstr ali  22  67.........TSKPCVNEGKCFSYPNGTFCRCPEGFLGDYCQYRNP--CESSTCQNGGTCTSVIGKATCKCAPGFRGEDC...... 137
471 2.000e-08gi|847014347|ref|XP_012804349.1| PREDICTED: neurogenic locus notch homolog protein 2 [Jaculus jaculus]  clstr ali  23  37............PCLNRGTCVTYHNGY-CKCPEGFWGEYCQHRDP--CEKNRCQNGGTCVAMLERAMCRCPPGFTGLACQ..... 105
472 2.000e-08gi|47215753|emb|CAG05764.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  39  482..............................................ECFLNPCQNKGTCEEIGAGYICTCMPGFTGAKCEVDID. 519
473 2.000e-08gi|1020544222|ref|XP_016108263.1| PREDICTED: neurogenic locus notch homolog protein 1-like isoform X1 [Sinocyclocheilus grahami]  clstr ali  24 1349........CGSLHCKNSGTCISGYKSPKCLCTPAFTGPECQYPTEGHCTTNPCYNGGTCISEAPYYHCICPTGFNGLFCHI.... 1423
474 2.000e-08gi|260818872|ref|XP_002604606.1| hypothetical protein BRAFLDRAFT_92840 [Branchiostoma floridae]  clstr ali  34 1108.............................................DPCSPDPC-NNGTCLSSIRDYKCTCSPGFTGTNCETDID. 1145
475 2.000e-08gi|403266214|ref|XP_003925288.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Saimiri boliviensis b  clstr ali  42 1195..............................................ECFLNPCHNGGTCQQLGLGYVCLCPLGYTGLKCETDID. 1232
476 2.000e-08gi|946738832|ref|XP_014389939.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Myotis brand  clstr ali  36 1123..............................................ECFLNPCHNSGTCQQLGHGYVCLCSPGYTGSKCETDID. 1160
477 2.000e-08gi|919005200|ref|XP_013383834.1| PREDICTED: neurogenic locus notch homolog protein 1-like isoform X2 [Lingula anatina]  clstr ali  20 1011.......EC--EPCKNNASCLTADGGINCVCSANFTGENCEPEVVDPCDDLPCLNNGTCTAKDTEYTCECLELYTGENCEL.... 1087
478 2.000e-08gi|432885067|ref|XP_004074641.1| PREDICTED: versican core protein-like [Oryzias latipes]  clstr ali  65.....VDECHSNPCLNGATCLDGIDSFTCACLPSYTGKLCEQ-DTEVCGS................................... 108
479 2.000e-08gi|823474697|ref|XP_012433247.1| PREDICTED: versican core protein [Taeniopygia guttata]  clstr ali  12  379.GEQCIDECQSNPCRNGATCIDSLNTFTCLCLPSYVGALCEQ........................................... 422
480 2.000e-08gi|344243172|gb|EGV99275.1| Slit-like 1 protein [Cricetulus griseus]  clstr ali  16 1036......DDCKDHRCQNGAQCVDEVNSYSCLCAEGYSGQFCEPAPRSPCEGTECQNGANCVDQGSRPVCQCLPGFGGPECE..... 1111
481 2.000e-08gi|780126702|ref|XP_011678701.1| PREDICTED: uncharacterized protein LOC105445190 [Strongylocentrotus purpuratus]  clstr ali  22  149.......PCSSSPCLSGGSCSDTPPTYQCTCTSAYVGTQCE-TEADECASNPCTHAQQCIDQLDSFECVCSSGFTGVLCETDI.. 228
482 2.000e-08gi|984091109|ref|XP_015336530.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Marmota marmota marmota]  clstr ali  42  696........................................QCLEVDECRSQPCLHGGSCQDHVAGYLCLCSRGYEGAHCELEVDA 740
483 2.000e-08gi|678208613|gb|KFV75593.1| Sushi, nidogen and EGF-like domain-containing protein 1, partial [Struthio camelus australis]  clstr ali  37  659........................................ECDEIDECRSQPCLNGGLCKDRVAEFLCVCEPGYTGHHCELEI.. 701
484 2.000e-08gi|943954338|ref|XP_014360098.1| PREDICTED: neural-cadherin isoform X1 [Papilio machaon]  clstr ali  33 2772............................YECTCPGGGGTC--VNVNECLGRPCLNGGTCVDRERRYDCVCALGYAGHDCELVLLA 2832
485 2.000e-08gi|909557698|ref|XP_013133828.1| PREDICTED: neural-cadherin isoform X6 [Papilio polytes]  clstr ali  33 2702............................YECTCPGGGGTC--VNVNECLGRPCLNGGTCVDRERRYDCVCALGYAGHDCELVLLA 2762
486 3.000e-08gi|936716028|ref|XP_014235942.1| PREDICTED: neurogenic locus protein delta [Trichogramma pretiosum]  clstr ali  24  273......NECL---CHNGWTCVRYPGPWECLCDEGWGGLFC-NQDLNYCTNHPCHNGGTCFNGQGSYTCACAPGFTGTDCET.... 359
487 3.000e-08gi|557322374|ref|XP_006034280.1| PREDICTED: neurogenic locus notch homolog protein 3 [Alligator sinensis]  clstr ali  29 1249.....INPCESAPCQNGGQCRPVPTGYACRCPQGFSGASCERS-PASCRELTCLNGGSCRASXXXRHCACLPGYTGPDC...... 1333
488 3.000e-08gi|585675458|ref|XP_006818779.1| PREDICTED: neurogenic locus notch homolog protein 1 [Saccoglossus kowalevskii]  clstr ali  22  74............PCQNGGTCTNGVN-FECICPIGFSATLCESPEANICEEQPCNNGGACI-LIQDYICQCAEGYIGDTCD..... 147
489 3.000e-08gi|954552704|ref|XP_014599812.1| PREDICTED: neurogenic locus protein delta-like [Polistes canadensis]  clstr ali  20  258......DQCVRYPCLHG-SCQKP---WECLCDEGWGGLFC-NQDLNYCTNHPCMNGGTCFNGQGSYTCSCAPGFTGTDCQT.... 330
490 3.000e-08gi|926687679|ref|XP_013817947.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 2 [Capra hircus]  clstr ali  23 1900.CETFVDVCPQMPCLNGGTCSNMPDGFICRCPPGFSGVRCQSSNPQDCASSPCQHGGRCH......................... 1989
491 3.000e-08gi|1002605193|ref|XP_015681851.1| PREDICTED: LOW QUALITY PROTEIN: protein crumbs homolog 2-like [Protobothrops mucrosquamatus]  clstr ali  37 1087.......................................CQGADI--CSSNPCHHAGSCLDLFNAFSCACQPEWEGPLCETNTD. 1129
492 3.000e-08gi|743747395|ref|XP_010968409.1| PREDICTED: LOW QUALITY PROTEIN: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [  clstr ali  42 1349..............................................ECFLNPCHRGGTCQQLGRGYVCLCPPGYTGLKCEIDID. 1386
493 3.000e-08gi|837833904|ref|XP_004597632.2| PREDICTED: delta-like protein 1 [Ochotona princeps]  clstr ali  22  254......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYSGANCELETD. 329
494 3.000e-08gi|946732711|ref|XP_014397823.1| PREDICTED: delta-like protein 1 [Myotis brandtii]  clstr ali  22  220......DQCIRYPCLHG-TCQ---QPWQCTCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGYTGATCEDEVD. 295
495 3.000e-08gi|752396648|ref|XP_011220999.1| PREDICTED: delta and Notch-like epidermal growth factor-related receptor [Ailuropoda melanoleuca]  clstr ali  24  413.....VDPCASSPCQNNGTCHAEGMYFSCSCSAGFTGPACAQL-VDFCALSPCAH-GTCHSVGTSYKCLCDPGYHGLYCE..... 485
496 3.000e-08gi|317419416|emb|CBN81453.1| Habp2-prov protein, partial [Dicentrarchus labrax]  clstr ali  32  31................GDCVVNLKKPPFYECKCRPPGPDCKSLPASPCEPNPCQNGGSCKKGNRRFRCTCPNGYTGKFCEN.... 97
497 3.000e-08gi|829911771|ref|XP_012592807.1| PREDICTED: hepatocyte growth factor activator isoform X4 [Microcebus murinus]  clstr ali  30  169................GGSCSNTQAPESYHCSC--PGAFTGKDCGTACLSSPCLNGGTCIVATGTTVCACPPGFAGRLCNIVPA. 236
498 4.000e-08gi|926624537|ref|XP_013777732.1| PREDICTED: neurogenic locus Notch protein-like [Limulus polyphemus]  clstr ali  1348........CVSNPCLNGGQCRPRRGGYTCLCPRATTGKHCETINDGECLSPLCQKDATSIDRID..................... 1403
499 4.000e-08gi|938083195|gb|KPP78272.1| protein crumbs 2-like [Scleropages formosus]  clstr ali  19  964......DTCQAEPCLNGGKCTVTWNNFVCFCTVNFTGRTCETRMW--CPSKPCAKGGHCMDLPGGYECI................ 1024
500 4.000e-08gi|531442838|gb|AGT57827.1| Notch [Euperipatoides rowelli]  clstr ali  21 1374.CESDINECLSSPCLHNGKCLDRVGKFECKCPAKWNGDRCETFDVNQCILNNCRNNGRCDEDCNSYACDCSLGF........... 1478
501 4.000e-08gi|528484888|ref|XP_695742.6| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Danio rerio]  clstr ali  39 1197..............................................ECLLNPCQNQGTCEEVGVGYVCTCLPGFTGAKCESDID. 1234
502 4.000e-08gi|1009372176|gb|KYM96309.1| Neurogenic locus protein delta [Cyphomyrmex costatus]  clstr ali  29  441...........................ECACDEGWGGLFC-NQDLNYCTNHPCMNGGTCFNGQGSYTCSCPSGFTGTECQT.... 495
503 4.000e-08gi|966673962|gb|KTG07343.1| hypothetical protein cypCar_00007315, partial [Cyprinus carpio]  clstr ali  39 1034..............................................ECLLNPCQNQGTCEEVGVGYVCTCLPGFTGAKCESDID. 1071
504 4.000e-08gi|852769420|ref|XP_012878679.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Dipodomys ordii]  clstr ali  36 1282..............................................ECFLNPCHNSGTCQQVGHGYVCQCTPGYTGLKCETNID. 1319
505 4.000e-08gi|431904616|gb|ELK09998.1| Delta-like protein 1 [Pteropus alecto]  clstr ali  21  223......DQCIRYPCLHG-TCQ---QPWQCTCQEGWGGLFC-NQDLNYCTHHPCRNGATCTNGQGSYTCSCRPGFAGADCEAETD. 298
506 4.000e-08gi|987416498|ref|XP_015396248.1| PREDICTED: hepatocyte growth factor activator [Panthera tigris altaica]  clstr ali  27  174GTERCFDETRYEHLEAGDRWARVSQGRVEQCECAGGQIRCEGTPLTA...................................... 220
507 4.000e-08gi|972194757|ref|XP_015179223.1| PREDICTED: neural-cadherin isoform X1 [Polistes dominula]  clstr ali  29 2783....CSEP-----FECIDLW------NEYDCTCGEGRIPSPDNKGCECIDYPCLNGGRCINQDYRYRCICPEGFWGENCEL.... 2854
508 5.000e-08gi|929278346|ref|XP_014015995.1| PREDICTED: protein crumbs homolog 1-like [Salmo salar]  clstr ali  15  996........CKAGPCKNGGTCTVTWNDFECTCPMNFSGRRCDTRVW--CVSDPCVVGSQCVDLVDGYEC................. 1053
509 5.000e-08gi|594050098|ref|XP_006049410.1| PREDICTED: neurogenic locus notch homolog protein 2 isoform X3 [Bubalus bubalis]  clstr ali  25  34............PCVNEGICVTYHNGY-CKCPEGFLGEYCQHRDP--CEKNRCQNGGTCVAQLGKATCRCASGFTGEDCQ..... 102
510 5.000e-08gi|470634594|ref|XP_004322844.1| PREDICTED: neurogenic locus notch homolog protein 2-like, partial [Tursiops truncatus]  clstr ali  23  9............PCVNEGICVTYHNGY-CKCPEGFLGEYCQHRDP--CEKNRCQNGGTCVAQLGKATCRCAPGFIGEDCQ..... 77
511 5.000e-08gi|156538238|ref|XP_001602323.1| PREDICTED: neurogenic locus protein delta [Nasonia vitripennis]  clstr ali  20  183......DQCVRYPCLHG-SCQKP---WECLCDEGWGGLFC-NQDLNFCTNHPCRNGGTCFNGQGSYTCACAAGFTGTDCETPI.. 257
512 5.000e-08gi|975099982|ref|XP_015265070.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Gekko japonicus]  clstr ali  42 1220..............................................ECFLEPCHNGGTCKQVGSGYICICPPGYTGLKCEVEID. 1257
513 5.000e-08gi|821133570|ref|XP_004475730.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Dasypus novemcinctus]  clstr ali  26 3231............PCLNGGRC---VAPYQCDCPRGWTGSRC-HTAV--CQS-PCLNGGKCV-RPN--RCHCLSAWIGHDC...... 3287
514 5.000e-08gi|928149688|ref|XP_013973390.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X2 [Canis lupu  clstr ali  39 1266..............................................ECFLNPCHNSGTCQQLGRGYVCLCPSGYTGLKCEIDID. 1303
515 5.000e-08gi|38347812|dbj|BAC41350.2| ligand Delta-1 [Cynops pyrrhogaster]  clstr ali  21  258......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCKNAATCTNGQGSYTCSCRPGYTGANCEIEV.. 332
516 5.000e-08gi|670977237|ref|XP_008684574.1| PREDICTED: LOW QUALITY PROTEIN: slit homolog 1 protein [Ursus maritimus]  clstr ali  21  902......DDCVEHTCANGGVCVDGVGNYSCRCPLQYTGRACEQL-VDFCSPNPCQHEAQCVGTPDGPRCECAPGYAGDNC...... 975
517 5.000e-08gi|831530643|ref|XP_012720905.1| PREDICTED: slit homolog 2 protein [Fundulus heteroclitus]  clstr ali  35 1087......................TPQGYKCECTPGYVGEHCE-LDYDDCEDNKCQNGGHCIDAVNGYTCICPEGYSGLFCE..... 1143
518 6.000e-08gi|1002570636|ref|XP_015686080.1| PREDICTED: neurogenic locus notch homolog protein 3 [Protobothrops mucrosquamatus]  clstr ali  26 1323........CRELFCFNGGNCWTSTLGAQCYCLAGWAGPDCRLRANSSCANQPCHNGGVCHEIATAFKCLCPSDYTGVHCKT.... 1397
519 6.000e-08gi|847111084|ref|XP_012814844.1| PREDICTED: neurogenic locus notch homolog protein 2 [Xenopus tropicalis]  clstr ali  24 1278........CESRPCQNGGVCSVTVNGYTCRCPLGFTGPSCCRTPNNSCSNSPCRNGATCIPNIHYYQCKCHPGMIGPRCDI.... 1398
520 6.000e-08gi|928149686|ref|XP_013973389.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Canis lupu  clstr ali  39 1266..............................................ECFLNPCHNSGTCQQLGRGYVCLCPSGYTGLKCEIDID. 1303
521 6.000e-08gi|1016690301|ref|XP_016068417.1| PREDICTED: delta-like protein 1 [Miniopterus natalensis]  clstr ali  22  185......DQCIRYPCLHG-TCQ---QPWQCTCQEGWGGLFC-NQDLNYCTHHPCKNGATCTNGQGSYTCSCRPGYTGATCETEVD. 260
522 6.000e-08gi|390364043|ref|XP_795071.3| PREDICTED: uncharacterized protein LOC590372 [Strongylocentrotus purpuratus]  clstr ali  11 1787GSYRCVCECSSLPCQNGGRCINGQGRYTCTCRLGYSGLNCEKV.......................................... 1843
523 6.000e-08gi|548339759|ref|XP_005722472.1| PREDICTED: versican core protein [Pundamilia nyererei]  clstr ali  35  370............................................IDSCTEDVCLNGGSCLRIGSTYTCHCAPGFSGHQCEIDID. 409
524 7.000e-08gi|828199480|ref|XP_012554603.1| PREDICTED: uncharacterized protein LOC100208285 [Hydra vulgaris]  clstr ali  15  793....DINECLNNPCRGGSQCTNLMGSYKCTCKSGFRETTCE--DIDECKSS----GKTCTNIDGGYFCSCEDGY........... 866
525 7.000e-08gi|795540729|ref|XP_011904350.1| PREDICTED: neurogenic locus notch homolog protein 1 [Cercocebus atys]  clstr ali  21  31.............CLNGGKCEAANGTEACVCGGAFVGPRCQ--DPNPCLSTPCKNAGTCVDGMADYACSCPLGFSGPLCLTPLD. 103
526 7.000e-08gi|556727811|ref|XP_005959648.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Pantholops hodgsonii]  clstr ali  24  131.............CLNGGKCEVFPNGTECICSGAFAGQQCQAPNP--CLSAPCKNGGTCHEGLVDYVCSCRLGFSGPLC...... 199
527 7.000e-08gi|820841784|ref|XP_012339232.1| PREDICTED: neurogenic locus protein delta [Apis florea]  clstr ali  18  218......DQCVRYPCLHG-SCQKP---WECLCDEGWGGLFC-NQDLNYCTNHPCLNGGTCFNTFNGYTCSCAPGFNGTNCE..... 291
528 7.000e-08gi|762132451|ref|XP_011449412.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Crassostrea gigas]  clstr ali  433.CETEINECESSPCSHG-VCLDEINAYQCVCDTGYYGRQCSYFDV........................................ 475
529 7.000e-08gi|966642552|gb|KTF77464.1| hypothetical protein cypCar_00003158 [Cyprinus carpio]  clstr ali  39  239..............................................ECLLNPCQNQGTCEEVGVGYVCTCVPGFTGAKCESDID. 276
530 7.000e-08gi|667315462|ref|XP_008586118.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Galeopterus variegatu  clstr ali  39 1115..............................................ECFLNPCHNSGTCQQLGRGYVCLCPPGYTGLKCEADID. 1152
531 7.000e-08gi|955500888|ref|XP_014637400.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ceratotherium simum s  clstr ali  39 1130..............................................ECFLNPCHNSGTCQQLGRGYVCLCPSGYTGLKCEIDID. 1167
532 7.000e-08gi|635062153|ref|XP_007965146.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X1 [Chlorocebus sabaeus]  clstr ali  42  750........................................QCLEIDECRSQPCLHGGSCQDHVAGYLCLCSTGYEGTHCELE... 791
533 7.000e-08gi|317419415|emb|CBN81452.1| Habp2-prov protein, partial [Dicentrarchus labrax]  clstr ali  32  79................GDCVVNLKKPPFYECKCRPPGPDCKSLPASPCEPNPCQNGGSCKKGNRRFRCTCPNGYTGKFCEN.... 145
534 8.000e-08gi|919038828|ref|XP_013402903.1| PREDICTED: fibropellin-1-like [Lingula anatina]  clstr ali  39  393.............................................DECVSNPCQNGGACNNLYNRFECTCAVGTTGTRCETDI.. 430
535 8.000e-08gi|992178601|ref|XP_015456929.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Astyanax mexicanus] :  clstr ali  39 1198..............................................ECFLNPCQNQGTCEEVGVGYVCTCLPGFTGAKCESDID. 1235
536 8.000e-08gi|591337947|ref|XP_007094547.1| PREDICTED: LOW QUALITY PROTEIN: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [  clstr ali  39 1213..............................................ECFLNPCHNSGTCQQLGRGYVCLCPSGYTGLKCETDID. 1250
537 8.000e-08gi|929102860|ref|XP_014062514.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like isoform X3 [Salmo  clstr ali  28 3480.............CLNGGVCQ-RPN--TCSCSEGWMGRLCEEP-I--CI-LPCLNGGRC---VAPYQCECPTGWMGTRC...... 3535
538 8.000e-08gi|260791906|ref|XP_002590968.1| hypothetical protein BRAFLDRAFT_119097 [Branchiostoma floridae]  clstr ali  177..ETEIDECSSSPCQNGATCQDGVNSFTCQCAPGYAGTLCETV.......................................... 217
539 8.000e-08gi|118091598|ref|XP_421132.2| PREDICTED: delta-like protein 4 isoform X1 [Gallus gallus]  clstr ali  18  362......DECIPHICRHG-TCKTQ---WQCICDEGWGGLFC-DQDLNYCTHHPCKNGATCMNGQGSYTCSCKPGFTGVDCEHEI.. 436
540 8.000e-08gi|533191952|ref|XP_005408819.1| PREDICTED: hepatocyte growth factor activator isoform X2 [Chinchilla lanigera]  clstr ali  30  173................GGTCSSTQDPTSYHCTCSA--AFTDRDCGTACLSSPCLNGGTCITGTGTSVCACPPGYAGRLCNIVPS. 240
541 9.000e-08gi|478529750|ref|XP_004439043.1| PREDICTED: protein crumbs homolog 1 isoform X3 [Ceratotherium simum simum]  clstr ali  10  758.CEKDIDECASNPCLNGGLCQDSLNKFQCLCDVAFAGERCE............................................ 797
542 9.000e-08gi|929102856|ref|XP_014062512.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like isoform X1 [Salmo  clstr ali  28 3544.............CLNGGVCQ-RPN--TCSCSEGWMGRLCEEP-I--CI-LPCLNGGRC---VAPYQCECPTGWMGTRC...... 3599
543 1.000e-07gi|987971397|ref|XP_015427846.1| PREDICTED: neurogenic locus notch homolog protein 1 [Myotis davidii]  clstr ali  10  707.CEVDINECVKSPCRHGASCQNTNGGYRCHCQAGYTGRN.............................................. 744
544 1.000e-07gi|919052991|ref|XP_013408400.1| PREDICTED: fibrillin-1-like [Lingula anatina]  clstr ali  10 2123....NIDECAGSPCENGGNCTDGVNAFVCLCPAGFTGSRCENI.......................................... 2161
545 1.000e-07gi|675758752|ref|XP_008985697.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 3 [Callithrix jacchus]  clstr ali  22 1200.CEADINECRSGACHHTRDCQDAGGGFRCLCHAGFSGPRCQTV-LSPCESQPCQHGGQCRPSPGTFTCHCV.............. 1276
546 1.000e-07gi|742103956|ref|XP_010870108.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 2-like [Esox lucius]  clstr ali  28  34............PCVNNATCVTFTNGY-CRCAAGYLGEYCHHKDP--CHPGYCKNGGNCLGVPGSPTCSCPLGYTGQHCQT.... 103
547 1.000e-07gi|953887766|ref|XP_014591732.1| PREDICTED: neurogenic locus notch homolog protein 1 [Equus caballus]  clstr ali  24  17.............CLNGGKCEVLANGTECICSGAFAGQRCQVPNP--CLSAPCKNGGTCVDRGGDYACSCSLGFSGPLC...... 85
548 1.000e-07gi|571560014|ref|XP_006566475.1| PREDICTED: neurogenic locus protein delta [Apis mellifera]  clstr ali  18  258......DQCVRYPCLHG-SCQKP---WECLCDEGWGGLFC-NQDLNYCTNHPCLNGGTCFNTFNGYTCSCAPGFNGTNCE..... 331
549 1.000e-07gi|902875048|ref|XP_013027681.1| PREDICTED: protein eyes shut homolog isoform X1 [Anser cygnoides domesticus]  clstr ali  17 1713........CGYSVCKNNGTCQVESSGFSCSCPQGWIGNTCEESVH--CSENRCGSRALCIPQPTSYTCVCALGWSGKHCDSKI.. 1787
550 1.000e-07gi|929077003|ref|XP_014048834.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Salmo salar]  clstr ali  20 1310........CGNLHCRNGGTCISGHKNPKCLCTSSFTGPECEYPTDNPCNTNPCYNGGTCESEAPYYHCVCPTNFNGLLCHI.... 1384
551 1.000e-07gi|938079027|gb|KPP75127.1| hypothetical protein Z043_105648 [Scleropages formosus]  clstr ali  26  6.........ATKPCVNNATCITFKNGTHCRCTPGFLGEYCHHRDP--CHPGYCLNGGNCSSVPGSPTCSCPLGFTGQNCQT.... 80
552 1.000e-07gi|909576860|ref|XP_013144227.1| PREDICTED: neurogenic locus Notch protein [Papilio polytes]  clstr ali  21  42........CSPSPCKNSGTCLSTPRGESCNCTSRYAGEFCQHLNPCHSESSPCQNGGTCRVRPGSFACDCPLGFSASLCEIRV.. 124
553 1.000e-07gi|973135115|ref|XP_015211472.1| PREDICTED: neurogenic locus notch homolog protein 2 [Lepisosteus oculatus]  clstr ali  26  32............PCVNNGTCVTFRNGY-CSCVSGFLGEYCQHRNP--CRQDSCQNGGNCSATLKGVSCICPLGYTGSQCET.... 103
554 1.000e-07gi|921301183|ref|WP_053236395.1| hypothetical protein [Sandaracinus amylolyticus]  clstr ali  163.CETNVDDCAPSLCMNGGTCVDGIDEHTCDCADGFGGDACE............................................ 203
555 1.000e-07gi|972968197|ref|XP_015201270.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Lepisosteus oculatus]  clstr ali  42 1196..............................................ECFLNPCQNRGTCEEVGAGYICLCPLGFTGSKCESDID. 1233
556 1.000e-07gi|884977118|ref|XP_012995788.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Esox lucius]  clstr ali  26 3543.............CQNGGLCQ-RPN--ICSCPEGWMGRLCEEPV---C-SSPCLNSGRCI-RPN--RCHCSPGWSGHDC...... 3598
557 1.000e-07gi|795293730|ref|XP_011821783.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Mandrillus leucophaeu  clstr ali  39 1093..............................................ECFLNPCHNSGTCQQLGRGYVCLCPLGYTGLKCETDID. 1130
558 1.000e-07gi|332222722|ref|XP_003260519.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Nomascus leucogenys]  clstr ali  39 1196..............................................ECFFNPCHNSGTCQQLGRGYVCLCPLGYTGLKCETDID. 1233
559 1.000e-07gi|126334857|ref|XP_001374633.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Monodelphi  clstr ali  34 1231..............................................ECFLNPCHNSGTCQQLGRGYVCICLPGFTGLKCEIDVD. 1268
560 1.000e-07gi|585662966|ref|XP_006886991.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Elephantulus edwardii  clstr ali  36 1195..............................................ECFLNPCHNSGSCQQLGRGYVCLCAPGYTGLKCETDID. 1232
561 1.000e-07gi|831218012|ref|XP_012657768.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Otolemur garnettii] :  clstr ali  36 1198..............................................ECFLNPCHNEGTCQQLGRGYVCLCLPGYTGLKCETDVD. 1235
562 1.000e-07gi|355750984|gb|EHH55311.1| hypothetical protein EGM_04492, partial [Macaca fascicularis]  clstr ali  43  678........................................QCLEIDECRSQPCLHGGSCQDHVAGYLCLCSTGYEGTHCELDEC. 721
563 1.000e-07gi|679197998|gb|KFW87216.1| Sushi, nidogen and EGF-like domain-containing protein 1, partial [Phalacrocorax carbo]  clstr ali  25  1.................................PGYLGANCQTEVNECESSPCLNGGHCVDLVDNYTCVCLEPFVGQRCET.... 48
564 1.000e-07gi|928069750|ref|XP_013884603.1| PREDICTED: EGF-like repeat and discoidin I-like domain-containing protein 3, partial [Austrofundulus limnaeus]  clstr ali  40  158...........................VCRCQPGFEGVHCQ-TNVNDCVNQPCKNGGTCQDLDGGFSCHCPSPYVGQQCQ..... 209
565 1.000e-07gi|546682864|gb|ERL92753.1| hypothetical protein D910_10062, partial [Dendroctonus ponderosae]  clstr ali  29  6.......PVLNENVHKNQLSDNIGHPQSIKNEIKQSNNHIEECTADRCSRVPCQHGGKCLTSETSAVCLCPLGFSGDLCEI.... 80
566 1.000e-07gi|817223157|ref|XP_012286889.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin [Orussus abietinus]  clstr ali  27 2755....CSDP-----FECIDLW------NMYDCTCGEGRIPSPDNKGCECIDYPCLNGGRCINQDFRYRCICPDGFWGENCEL.... 2826
567 2.000e-07gi|939685016|ref|XP_014299897.1| PREDICTED: neurogenic locus protein delta-like [Microplitis demolitor]  clstr ali  548....DVDECKSAPCRNGGICENRVNGFFCDCKKGWRGDTCSDPD......................................... 587
568 2.000e-07gi|1016158301|gb|KZC05463.1| Neurogenic locus protein delta [Dufourea novaeangliae]  clstr ali  672....DVDECRSGPCKNGGICRNRVNGFICECPNGWHGDT.............................................. 706
569 2.000e-07gi|970746697|ref|XP_015106741.1| PREDICTED: neurogenic locus notch homolog protein 1 [Vicugna pacos]  clstr ali  20  76.........TSETCLNGGKCEVSLNGTECVCSAAFAGQRCQAPNP--CLSAPCKNSGTCVDGVVDYACSCRLGFSGPLC...... 148
570 2.000e-07gi|242009671|ref|XP_002425606.1| notch, putative [Pediculus humanus corporis]  clstr ali  1370......NECASNPCQHEAACQDLVGDYNCFCPPSWTGKNCHIYDI........................................ 1408
571 2.000e-07gi|260827625|ref|XP_002608765.1| hypothetical protein BRAFLDRAFT_73991 [Branchiostoma floridae]  clstr ali  30  320.............................TCACGWEGQTCQEEKRDYCDPTPCENGGTCTDEDTCFVCACPAGFIGQVCETDVD. 377
572 2.000e-07gi|826461967|ref|XP_012534383.1| PREDICTED: neurogenic locus protein delta [Monomorium pharaonis]  clstr ali  29  276...........................ECACDEGWGGLFC-NQDLNYCTNHPCMNGGTCFNGQGSYTCSCPSGFTGTECQT.... 330
573 2.000e-07gi|585692488|ref|XP_006821460.1| PREDICTED: uncharacterized protein LOC100366622, partial [Saccoglossus kowalevskii]  clstr ali  25  860..........................FICECGPGFYTFNC--FNIDDCTPNPCLNGATCVDAIQDYSCLCTIEYNGKNCQ..... 917
574 2.000e-07gi|821101278|ref|XP_012373517.1| PREDICTED: neurogenic locus notch homolog protein 2 [Dasypus novemcinctus]  clstr ali  25  188............PCVNEGICITYHNGY-CKCPEGFLGEYCQHRDP--CEKNRCQNGGTCVAQLGKAMCRCATGFTGEDCQ..... 256
575 2.000e-07gi|542223573|ref|XP_005451249.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X2 [Oreochromis niloticus]  clstr ali  34 1227..............................................DCRSLPCQNGGTCVNGGDSFICDCAAGFKGRQCEL.... 1261
576 2.000e-07gi|542223571|ref|XP_005451248.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X1 [Oreochromis niloticus]  clstr ali  34 1257..............................................DCRSLPCQNGGTCVNGGDSFICDCAAGFKGRQCEL.... 1291
577 2.000e-07gi|558220050|ref|XP_006135580.1| PREDICTED: LOW QUALITY PROTEIN: protein eyes shut homolog [Pelodiscus sinensis]  clstr ali  22 2076.............CKNNGKCQIQNSSFSCSCPQSWTGNTCEQSVY--CSKNRCLHQALCIPDIFSYSCACTLGWSGSYCDNET.. 2145
578 2.000e-07gi|686589874|ref|XP_009270731.1| PREDICTED: fibropellin-1-like [Aptenodytes forsteri]  clstr ali  26  30.................................GFTGQFCEA-EVAACLSQPCGASSICKDILGGYLCFCAPGFIGNNCEIEVD. 79
579 2.000e-07gi|926534427|ref|XP_013816565.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Apteryx australis man  clstr ali  34 1097..............................................ECFLEPCHNNGTCKQLGSGYTCICPLGYTGLKCETEID. 1134
580 2.000e-07gi|946635188|ref|XP_006118909.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Pelodiscus s  clstr ali  34 1185..............................................ECFLEPCHNNGTCKQLGSGYICICPPGYTGLKCEKEID. 1222
581 2.000e-07gi|585677795|ref|XP_006819207.1| PREDICTED: fibropellin-1-like, partial [Saccoglossus kowalevskii]  clstr ali  33  285..............................CLDGQYGPTC--VDIDECWSSPCLNGGACTNVDNGFICVCPEGYDGNTCEIQI.. 335
582 2.000e-07gi|634875130|ref|XP_007948690.1| PREDICTED: delta-like protein 1 [Orycteropus afer afer]  clstr ali  24  259......DQCIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCGNGATCTNGQGSYTCSCRPGYTGPTCESEV.. 333
583 2.000e-07gi|620954459|ref|XP_007657500.1| PREDICTED: delta-like protein 1, partial [Ornithorhynchus anatinus]  clstr ali  21  31......DECIRYPCLHG-TCQ---QPWQCNCQEGWGGLFC-NQDLNYCTHHPCQNGATCTNGQGSYTCSCRPGYNGANCEMEI.. 105
584 2.000e-07gi|558187810|ref|XP_006128770.1| PREDICTED: delta-like protein 4 [Pelodiscus sinensis]  clstr ali  20  268......DECIPHICRHG-TCKTQ---WQCICDEGWGGLFC-DQDLNYCTHHPCKNGATCLNGQGSYTCSCKPGFTGVDCEHEI.. 342
585 2.000e-07gi|504176054|ref|XP_004597519.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Ochotona princeps]  clstr ali  35 2224...............................................CSENPCHNGGTCVPGAETYSCDCAPGFKGRRCEL.... 2257
586 2.000e-07gi|908551770|ref|XP_013122238.1| PREDICTED: hepatocyte growth factor activator isoform X3 [Oreochromis niloticus]  clstr ali  30  113..............QNGGVCTAIPHRRTFECSC--PEGFSGRICEQMCRTNPCQNDGTCIISTGKEVCNCRHGYSGPHCSLEPE. 182
587 3.000e-07gi|736310455|ref|XP_010795804.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Notothenia coriiceps]  clstr ali  36  971..............................................ECFLNPCQNKGTCEEVGAGYVCTCMPEFTGAKCEIDID. 1008
588 3.000e-07gi|1005477109|ref|XP_015775315.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Acropora digitifera]  clstr ali  769...TDIDDCVNHTCTNGAVCIDGINSYSCNCSVGFSGEHCEN........................................... 807
589 3.000e-07gi|22770986|gb|AAN06819.1| notch-like protein [Rhipicephalus microplus]  clstr ali  24  31........CSPNPCKNGASCVNPSGESHCNCPPLYVGEYCQHANP--CHTGPCQNGGTCMSVTNGFSCRCPVGYSATMCEIKV.. 114
590 3.000e-07gi|759148591|ref|XP_011368282.1| PREDICTED: neurogenic locus notch homolog protein 1 [Pteropus vampyrus]  clstr ali  20  208..........SETCLNGGKCEVFLNGSECLCGEAFAGQRCQAHSP--CLSAPCKNAGTCHGGVLAYTCSCRLGFSGPLC...... 279
591 3.000e-07gi|617660328|ref|XP_007537135.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Erinaceus eu  clstr ali  39  793..............................................ECFLNPCHNSGTCQQLGRGYVCLCLPGYTGLKCEIDTD. 830
592 3.000e-07gi|465965700|gb|EMP30778.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Chelonia mydas]  clstr ali  31  614.....................................KRCQTSQVFECFLEPCHNNGTCKQLGSGYICMCPPGYTGLKCEKEID. 661
593 3.000e-07gi|927125424|ref|XP_013908079.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Thamnophis sirta  clstr ali  26  961.............CLNGGRC---VAPYQCDCPTGWTGSRCHQAV---CHS-PCLNGGKCI-RPN--RCHCTSPWTGHDC...... 1016
594 3.000e-07gi|850306947|ref|XP_012862262.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Echinops tel  clstr ali  39 1085..............................................ECFLNPCHNRGTCQQLGLGYVCLCPSGYTGLKCETDID. 1122
595 3.000e-07gi|926530748|ref|XP_013814673.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 4 [Apteryx australis mantelli]  clstr ali  18  255......DECIPHICRHG-TCKTQ---WQCICDEGWGGLFC-DQDLNYCTHHPCKNGATCMNGQGSYTCSCKPGFTGVDCEHEI.. 329
596 3.000e-07gi|690431675|ref|XP_009317541.1| PREDICTED: delta-like protein 4 [Pygoscelis adeliae]  clstr ali  18  233......DECIPHICRHG-TCKTQ---WQCICDEGWGGLFC-DQDLNYCTHHPCKNGATCMNGQGSYTCSCKPGFTGVDCEHEI.. 307
597 3.000e-07gi|676778833|gb|KFP05938.1| Delta-like 4, partial [Calypte anna]  clstr ali  18  230......DECIPHICRHG-TCKTQ---WQCICDEGWGGLFC-DQDLNYCTHHPCKNGATCMNGQGSYTCSCKPGFTGVDCEHEI.. 304
598 3.000e-07gi|874499512|ref|XP_012963654.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 4 [Anas platyrhynchos]  clstr ali  18  279......DECIPHICRHG-TCKTQ---WQCICDEGWGGLFC-DQDLNYCTHHPCKNGATCMNGQGSYTCSCKPGFTGVDCEHEI.. 353
599 3.000e-07gi|847165336|ref|XP_012826286.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X5 [Xenopus tropicalis]  clstr ali  30  971........................................ECEEIDECASHPCHNGASCKDRISHFICECQKGYSGKYCEQET.. 1013
600 3.000e-07gi|999974622|gb|KXJ13796.1| Neurogenic locus notch-like protein 2 [Exaiptasia pallida]  clstr ali  33  69..........................................TDINECNSNPCGAHGQCTDLINAYKCTCNAGYTGSACQFDID. 110
601 4.000e-07gi|743720917|ref|XP_010954271.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Camelus bactrianus]  clstr ali  20  27.........TSETCLNGGKCEVSLNGTECVCSAAFAGQRCQAPNP--CLSAPCKNSGTCVDGVVDYACSCRLGFSGPLC...... 99
602 4.000e-07gi|432889034|ref|XP_004075112.1| PREDICTED: protein crumbs homolog 2-like [Oryzias latipes]  clstr ali  14  966......DTCKVKPCRNGGECSVLFNDFACSCLEEYTGKTCETRVW--CVKNPCMEGSHCVDLPAGYECI................ 1026
603 4.000e-07gi|947321093|ref|XP_014437525.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Tupaia chinensis]  clstr ali  20 1304.CESVVDGCKGKPCKNGGVCSNTPRGFICRCPAGFEGATCEN-DARTCGSLRCLNGGTCI......................... 1364
604 4.000e-07gi|755973195|ref|XP_011306933.1| PREDICTED: neurogenic locus protein delta [Fopius arisanus]  clstr ali  565....EVDECKSAPCQNGGICTNRVNEFLCECKKGWRGGTCSEPD......................................... 604
605 4.000e-07gi|625291068|ref|XP_007637278.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 isoform X2 [Cricetulus griseus]  clstr ali  21 1570.CENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCVSNPCYNQGTCEPTSESYRCLCPAKFNGLLCHI.... 1652
606 4.000e-07gi|537271432|gb|ERE92073.1| putative neurogenic locus notch-like protein [Cricetulus griseus]  clstr ali  23  34............PCVNEGTCVTYHNGY-CRCPEGFLGEYCQHRDP--CEKKRCQNGGVCVTHLGDAICRCASGFTGEDCQ..... 102
607 4.000e-07gi|657539103|ref|XP_008275774.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X2 [Stegastes partitus]  clstr ali  11  617......DPCASSPCLNGGTCFHYIGKYKCECTDAFSGRHCE............................................ 651
608 4.000e-07gi|512972160|ref|XP_004848194.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Heterocephalus glaber  clstr ali  39 1196..............................................ECFLNPCHNSGTCQQLGRGYVCLCPLGYTGLKCEADID. 1233
609 4.000e-07gi|919012252|ref|XP_013390582.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Lingula anatina]  clstr ali  12 1260.CEININECAGSPCVRG-TCIDDVNDYYCACPHYYSGKNCERRET------PCFN.............................. 1306
610 4.000e-07gi|676458934|ref|XP_009055137.1| hypothetical protein LOTGIDRAFT_161520, partial [Lottia gigantea]  clstr ali  37  305..............................................ECDSHPCRNGGTCLDLFNGFICKCNSYWTGPTCETDV.. 341
611 4.000e-07gi|970726970|ref|XP_015098961.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 isoform X4 [Vicugna pacos]  clstr ali  38  622........................................QCHEIDECRSQPCLHGGSCQDRVAGYLCVCSPGHEGAHCELETD. 665
612 4.000e-07gi|984091065|ref|XP_015336504.1| PREDICTED: delta and Notch-like epidermal growth factor-related receptor, partial [Marmota marmota marmota]  clstr ali  25  77.................................PGYHGLYCEEEYNECLSAPCLNTATCRDLVNGYECVCLAEYKGTHCELDPCA 130
613 5.000e-07gi|929315109|ref|XP_014035362.1| PREDICTED: delta-like protein D isoform X1 [Salmo salar]  clstr ali  18  253......DDCIRYPCLHG-TCQ---QPWQCNCLEGWGGLFC-NQDLNYCTHHPCMNGATCTNGQGSYTCSCKPGFSGASCGIEV.. 327
614 5.000e-07gi|734620529|ref|XP_010738119.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Larimichthys crocea]  clstr ali  11  636......DPCASSPCLNGGTCFHYIGKYKCECTEDFSGRHCE............................................ 670
615 5.000e-07gi|999989325|gb|KXJ28367.1| Fibropellin-1 [Exaiptasia pallida]  clstr ali  36  456...................................................PCQNGAVCISSPGGYTCLCKPGFTGTNCELDVD. 488
616 5.000e-07gi|1005421200|ref|XP_015760611.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Acropora digiti  clstr ali  2581....NVDECSSSPCIHG-TCEDGINQYDCVCNKGYWGTNCEKQIHDE...................................... 2622
617 5.000e-07gi|700399860|ref|XP_009940755.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Opisthocomus hoazin]  clstr ali  14  379.CEINLDDCASNPCDYG-KCIDKINGYECTCEPGYTG---ESR-----AGRPPQHTGVCNDGPQSYRCDCNPGWSGTNCDIN... 477
618 5.000e-07gi|1016164818|gb|KZC11980.1| Neurogenic locus Notch protein [Dufourea novaeangliae]  clstr ali  12 1202......DECASNPCQSNAVCKNLLGDYACDCPPKWTGKNCEIYDSN....................................... 1242
619 5.000e-07gi|999971285|gb|KXJ10459.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Exaiptasia pallida]  clstr ali  32  420...............................................CTSNPCQNDGVCIKHAAGYWCDCQPGYGGENCQNKID. 457
620 5.000e-07gi|729740939|ref|XP_010566725.1| PREDICTED: delta and Notch-like epidermal growth factor-related receptor [Haliaeetus leucocephalus]  clstr ali  22  361............PCSGKGKCITKPDEATFFCDCEDEYQGSLCEEFDACQSQPCQNNATCTDDRNNFTCSCPAGYTGELCQSEID. 437
621 5.000e-07gi|944349695|ref|XP_014378171.1| PREDICTED: zonadhesin [Alligator sinensis]  clstr ali  33 1323....CGCSWHQRYYQMNETFFT--PGCTQRCTCHGPETLCPPGLVCACLSSPCKNGGHCWELDGGFVCDCLQGYEGPRCET.... 1416
622 5.000e-07gi|405976351|gb|EKC40861.1| Neurogenic locus Notch protein [Crassostrea gigas]  clstr ali  41  399...........................VASCRCVCPGANCSVSTVNECRSSPCQNGGTCMDEIGYYTCKCPPEYSGYNCD..... 455
623 5.000e-07gi|669276628|ref|XP_008630560.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 3 [Corvus brachyrhynchos]  clstr ali  33 1293..................................NGTAAGCHAKHTFCDSSPCKNGGTCSVSWGTYSCLCPVGFGGKDC...... 1337
624 5.000e-07gi|645002338|ref|XP_008209926.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin [Nasonia vitripennis]  clstr ali  31 2831..............................CTCGEGRVPSPDNKGCECIDYPCLNGGRCINQDFRYRCICPDGFWGENCEL.... 2887
625 5.000e-07gi|665798423|ref|XP_008547086.1| PREDICTED: neural-cadherin isoform X1 [Microplitis demolitor]  clstr ali  32 2774..............................CTCGEGKVRSPDGKGCECIDYPCLNGGRCINQDPRYRCICPDGFWGENCE..... 2829
626 6.000e-07gi|602668455|ref|XP_007439775.1| PREDICTED: neurogenic locus notch homolog protein 1, partial [Python bivittatus]  clstr ali  22  10.............CLNGGKCETYQNGTVCLCPNDFVGHRCQFPNL--CLSSPCKNAGTCRPVVDGYTCSCHLGFTDKLC...... 78
627 6.000e-07gi|585155748|ref|XP_006730206.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Leptonychotes weddellii]  clstr ali  23  34............PCVNEGVCVTYHNGTYCKCPEGFLGEYCQHRDP--CEKNRCQNGGTCVAQLGKATCRCALGFTGDDCQ..... 102
628 6.000e-07gi|625281728|ref|XP_007632521.1| PREDICTED: neurogenic locus notch homolog protein 2 isoform X2 [Cricetulus griseus]  clstr ali  35  2.......................LGDAICRCASGFTGEDCQYSTSHPCVSRPCLNGGTCHMLSDTYECTCQVGFTGKLCQ..... 60
629 6.000e-07gi|827553314|ref|XP_012548353.1| PREDICTED: LOW QUALITY PROTEIN: protein eyes shut-like [Bombyx mori]  clstr ali  40  27...............................................CLSNPCLHG-ICIDDVNSYSCYCVDGYTGVQCQTNWD. 63
630 6.000e-07gi|768446435|ref|XP_011565157.1| PREDICTED: protein eyes shut-like [Plutella xylostella]  clstr ali  40  192...............................................CLSNPCLHG-ICIDDVNSYSCYCVDGYTGVQCQTNWD. 228
631 6.000e-07gi|47207800|emb|CAF96703.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  20 1164.GERCVNECLSDPCDPRGSCIQLTNSYRCECRTGYTGGQRCDKVFDGCKGRPCRNGGTCAVASNGFICKCPPGFTGSSCEYN... 1281
632 6.000e-07gi|641722271|ref|XP_008150893.1| PREDICTED: neurogenic locus notch homolog protein 1 [Eptesicus fuscus]  clstr ali  21 1353........CGSLRCLNGGTCISGPRSPACLCLGPFTGPECQFPASSPCAGNPCYNQGTCEPTSESYRCLCPPKFNGLLCHI.... 1428
633 6.000e-07gi|871215024|ref|XP_012934800.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Aplysia californ  clstr ali  23 2037.......WCQRNPCMNGGSCVEVEQNYVCRCEHGWTGDRCEVRVEPSCDLSPCVNGGTCLPSPSGYTCVC............... 2111
634 6.000e-07gi|928129855|ref|XP_013967786.1| PREDICTED: hepatocyte growth factor activator isoform X1 [Canis lupus familiaris]  clstr ali  38  229.............................................DSCASSPCLNGGSCTQDPGSYHCTCPMAFTGRNCDTEKC. 269
635 6.000e-07gi|1020507770|ref|XP_016092902.1| PREDICTED: neurocan core protein-like [Sinocyclocheilus grahami]  clstr ali  48  966.............................................DPCQTNPCLHGGSCLTEGEGYSCLCPQGYSGESCEIE... 1002
636 7.000e-07gi|919056848|ref|XP_013410239.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Lingula  clstr ali  7....DIDECTGVSCGQGGTCIDKLNDFTCICAPGYTGQLC............................................. 42
637 7.000e-07gi|752421202|ref|XP_011229910.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Ailuropoda melanoleuca]  clstr ali  21  69..........SDSCLNGGKCEVFPNGTECICSGAFVGQRCQAPNP--CLSAPCKNAGTCVDRGGDYACTCRLGFSGPLC...... 140
638 7.000e-07gi|498993527|ref|XP_004553021.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Maylandia zebra]  clstr ali  1189.......DCRSLPCQNGGTCVNGGDTFICDCADGFKGRQCE............................................ 1222
639 7.000e-07gi|950950608|ref|XP_014451816.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Alligator mississippi  clstr ali  34 1213..............................................ECFLEPCHNNGTCKQLGSGYICICPSGYTGLKCELEID. 1250
640 7.000e-07gi|817066502|ref|XP_012255092.1| PREDICTED: neural-cadherin isoform X3 [Athalia rosae]  clstr ali  26 2764....CPDP-----FECVDLW------NEYDCTCGDGRIPSPDVDKNECIDYPCLNGGSCINENPSYRCVCPDGFWGENCEL.... 2835
641 7.000e-07gi|939255871|ref|XP_014247707.1| PREDICTED: neural-cadherin isoform X1 [Cimex lectularius]  clstr ali  26 2725....CPDP-----FECVDLW------NEYECTCGEGRIVSPDTDKNECLESPCRNGGRCINHDPRYRCDCPEGFWGENCEL.... 2796
642 8.000e-07gi|483502904|gb|EOA95794.1| Neurogenic locus notch-like protein 2, partial [Anas platyrhynchos]  clstr ali  32  2............................CRCREGFLGDYCQYRNP--CESNTCKNGGTCTSLIGKATCKCAPGFTGEDCQ..... 53
643 8.000e-07gi|260786234|ref|XP_002588163.1| hypothetical protein BRAFLDRAFT_68801 [Branchiostoma floridae]  clstr ali  14  989.....FDPCMSNPCLNGGICSDEDNGYSCECVGRWTGDNC............................................. 1024
644 8.000e-07gi|611970049|ref|XP_007480133.1| PREDICTED: delta-like protein 4 [Monodelphis domestica]  clstr ali  22  239.......ECLCRPGWQGRLCDKCIPHNGCQCTCNGWGGLFCDQDLNYCTHHPCQNGGTCSNGQRGYTCTCRPGFTGIDCEDEI.. 326
645 9.000e-07gi|511874826|ref|XP_004757439.1| PREDICTED: neurogenic locus notch homolog protein 1 [Mustela putorius furo]  clstr ali  22  244.............CLNGGKCEVFPNGTECVCSGAFAGQRCQAPNP--CLSAPCKNAGTCVDRGGDYACTCRLGFSGPLC...... 312
646 9.000e-07gi|671023436|ref|XP_008702542.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Ursus maritimus]  clstr ali  21  14..........SDSCLNGGKCEVFPNGTECICSGAFVGQRCQAPNP--CLSAPCKNAGTCVDRGGDYACTCRLGFSGPLC...... 85
647 9.000e-07gi|1005421212|ref|XP_015760681.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Acropora digiti  clstr ali  2273....NVDECSSNPCVHG-NCEDGVNRYDCVCNKGFWGTNCER-KIDD...................................... 2313
648 9.000e-07gi|817281773|ref|XP_012311032.1| PREDICTED: delta-like protein 1, partial [Aotus nancymaae]  clstr ali  231....NVDDCASSPCANGGTCRNGVNDFSCTCPPGYTG-RNCSAPVSRCEHAPCH............................... 279
649 1.000e-06gi|970887086|ref|XP_015108633.1| PREDICTED: neurogenic locus Notch protein [Diachasma alloeum]  clstr ali  11 1384.CEIDIDECVSNPCQSDAICQDLVGDYACSCPPKWTGKNCEIYDKN....................................... 1430
650 1.000e-06gi|805758494|ref|XP_012149102.1| PREDICTED: neurogenic locus protein delta [Megachile rotundata]  clstr ali  20  258......DQCVRYPCLHG-SCQKP---WECLCDEGWGGLFC-NQDLNYCTNHPCVNGGTCFNGQGLYTCSCAPGFTGIDCQT.... 330
651 1.000e-06gi|992216808|ref|XP_015462352.1| PREDICTED: protein eyes shut homolog [Astyanax mexicanus]  clstr ali  22  193........CQNSPCSGNGACRAKVGEYRCHCDKHYSGLYCEY--FDACSEMPCLNGATC--LSNSYECLCPPQFTGVNC...... 273
652 1.000e-06gi|431899010|gb|ELK07380.1| Neurogenic locus notch like protein 1 [Pteropus alecto]  clstr ali  20 1509.CENDARTCGSLRCLNGGTCTSGPRSPTCLCRSAFTGRECQFPAGSPCVSNPCYNQGTCEPTSESYRCLCPAKFNGLLCHI.... 1591
653 1.000e-06gi|1020520429|ref|XP_016099603.1| PREDICTED: protein crumbs homolog 1-like [Sinocyclocheilus grahami]  clstr ali  18  961........CKMRPCQNGGKCRVIWNDFVCSCPLNFSGKTCDTRVW--CVSDPCDSGTRCVDLPDGYEC................. 1018
654 1.000e-06gi|699694849|ref|XP_009905887.1| PREDICTED: protein eyes shut homolog, partial [Picoides pubescens]  clstr ali  22  176........CQGSPCSGHGRCLSHLRDYRCHCSSHYSGRFCQSFDV--CSTNPCRNKGSCTARPGAYECRCPPMFSGQNC...... 254
655 1.000e-06gi|992172938|ref|XP_015459332.1| PREDICTED: protein crumbs homolog 2-like [Astyanax mexicanus]  clstr ali  16  932..ENCVSDCKDNPCVNGGECQLVWNDFVCSCSLNYTGKTCDTRVW--CVSDPCVMGSQCVDLPDGYEC................. 997
656 1.000e-06gi|821115122|ref|XP_012381462.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 1 [Dasypus novemcinctus]  clstr ali  21 1531.CENDARTCGTLHCLNGGTCLSGPRSPTCLCLGPFTGPECQFPASSPCAANPCYNQGSCEPTAESYRCLCPPKFNGLLCHI.... 1613
657 1.000e-06gi|915661158|gb|KOC63778.1| Neurogenic locus Notch protein, partial [Habropoda laboriosa]  clstr ali  10  859......DECASNPCQSNAVCKNLLGDYACDCPPKWTGKNCEIYDPN....................................... 899
658 1.000e-06gi|939667365|ref|XP_014280785.1| PREDICTED: protein eyes shut isoform X1 [Halyomorpha halys]  clstr ali  248.GERCYDECQKGPCLNGGTCIDGVDSYTCSCPLGLLGRFCECI.......................................... 293
659 1.000e-06gi|390335682|ref|XP_781372.3| PREDICTED: uncharacterized protein LOC575916 [Strongylocentrotus purpuratus]  clstr ali  211.CEIDVDDCRSVPCQNAGTCNTLLGGYTCDCLISYTGTNCET........................................... 252
660 1.000e-06gi|537217432|gb|ERE82041.1| sushi, nidogen and EGF-like domain-containing protein 1 [Cricetulus griseus]  clstr ali  40 2029...................................................PCLNGGKCIDGNPSYTCSCLAGFTGRRCHLDV.. 2064
661 1.000e-06gi|585646695|ref|XP_006811778.1| PREDICTED: fibropellin-1-like [Saccoglossus kowalevskii]  clstr ali  196..ETNVDECAPNPCMNGGTCVDLLNFYNCQCPVGFGGTNCENL.......................................... 236
662 1.000e-06gi|926695131|ref|XP_013820509.1| PREDICTED: neurogenic locus notch homolog protein 3 [Capra hircus]  clstr ali  29 1257.......PCESQPCQHGGQCRPSPGTFSCHCIPPFWGPRCERVARSCCVTSPCLHGGSCRPEPLAFGCACAPGWTGPRCEV.... 1382
663 1.000e-06gi|765117331|ref|XP_011472234.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Oryzias latipes]  clstr ali  27  28....CVD--NKAPCINNATCVTFDNGTECRCAAGFLGEYCQHE--DPCQPGHCLNRGTCSVSPGSALCTCPLGYTGERCQT.... 108
664 1.000e-06gi|632935107|ref|XP_007887824.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Callorhinchus milii]  clstr ali  1238.......ECSSNPCKNGGTCVRSMDSYTCDCDPGFKGKNCE............................................ 1271
665 1.000e-06gi|938064580|gb|KPP65442.1| delta and Notch-like epidermal growth factor-related receptor-like, partial [Scleropages formosus]  clstr ali  26  212.................GKCDTQPSKSTFYCVCGYSGIFCE--EFDACHQNPCKNNGTCSDLRQGFTCTCSPGYTGEHCE..... 279
666 1.000e-06gi|241784723|ref|XP_002400469.1| hypothetical protein IscW_ISCW015131 [Ixodes scapularis]  clstr ali  32  25.......................GPGDSFQCRCVAGGDFCQ-VDVDECFSSPCLNGGKCQDHPGGFVCSCDFGWTGEVCEV.... 83