current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2NAZ Entity 1(prereleased), from PDB0516

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MEDEVAQRIEFDDLVIDNGGRSVTLNGELVDFTSAEYDLLWLLASNAGRILSREDIFERLRGIEYDGQDRSIDVRISRIRPKIGDDPENPKRIKTVRSKGYLFVKETNGLLELast
1 -37.500 VFG001386(gi:15607897) (phoP) Possible two component system response transcriptional positive regulator PhoP [PhoP (VF0286)] [Mycobacterium tuberculosis H37Rv]  ali follow..  25  144.KEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKI--DTGEKRLLHTLRGVGYVLREPR..... 247
2 -27.600 VFG041911(gi:28901187) (vtrA) type III secretion system transcriptional regulator [T3SS2 (VF0409)] [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  25  2....TSKKYRIDQKILSSDSPFLISLGDRVKLGTHEHLVLLALCEQPGTLLDKETLIEKGWPGKFVT-DSSLTQAIRNIRAHLNDNGKSQKHIKTIAKKGYLIEKDYVQSLE 110
3 -27.200 VFG000349(gi:218928451) (psaE) regulatory protein PsaE [Myf/pH6 antigen (VF0134)] [Yersinia pestis CO92]  ali follow..  20  4............CVVLNKLESVLIIGDSRYALSKNEVLLLECLYLRAGDVISHDELLTTCWPDRV--SPTSLPVAIKHIRDVFRKITRS-EVIKTYKNEGYSYQKD...... 95
4 -25.000 VFG000089(gi:15640843) (tcpP) toxin co-regulated pilus biosynthesis protein P [TCP (VF0126)] [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  15.......WWNECTNQVYYAQDPMKPERLIGTPSIIQTKLLKILCEYHPAPCPNDQIIKALWPHGFIS-SESLTQAIKRTRDFLNDEHKT--LIENVKLQGYRINIIQVIVSE 116
5 -21.700 VFG002471(gi:53722574) (bprP) regulatory protein [Bsa T3SS (VF0428)] [Burkholderia pseudomallei K96243]  ali follow..  16  17.RHILSKYQIDGSVVFDSQAMTLSRGDIVTTLTANETELLCILMQG---TASKQAVIEQIWEKGLFVTEGSYHQLVRALRVKLDEQGIPPTQVKTLPRLGLRFLGF...... 119
6 -8.400 VFG002542(gi:53722590) (bspR3) N-acylhomoserine lactone-dependent regulatory protein [Quorum-sensing (VF0433)] [Burkholderia pseudomallei K96243]  ali follow..  18  164...........................PSVHLTDREQMCLTWVAR--GKSSWVIANMLDI-------SKYTVDFHIENAMEKLNTRSRTFAAVKATR............... 224
7 -8.210 VFG002543(gi:53721347) (bspR4) LuxR family transcriptional regulator [Quorum-sensing (VF0433)] [Burkholderia pseudomallei K96243]  ali follow..  16  170...........................GSCDLTARERESLQWAGR--GKTAWEISKILGI-------SERTVVFHLSNAARKIGANNRAQAVVIASA............... 230
8 -8.090 VFG002540(gi:53722204) (bspR2) N-acyl-homoserine lactone dependent regulatory protein [Quorum-sensing (VF0433)] [Burkholderia pseudomallei K96243]  ali follow..  18  170...........................FDPDLTRRETDVLKWTAD--GKTAYEIALILSI-------SESTVNFHVKNIVSKLGSTNKIQAVAKAAL............... 230
9 -8.040 VFG002413(gi:15799999) (ykgK/ecpR) regulator protein EcpR [ECP (VF0404)] [Escherichia coli O157:H7 str. EDL933]  ali follow..  10  144..............................KITDREMEIIRMTAQG----MLPKSIARIE-------SVKTVYTHRRNAEAKLYSKLYK....................... 193
10 -7.910 VFG004125(gi:16764498) (csgD) DNA-binding transcriptional regulator CsgD [curli fibers/thin aggregative fimbriae (AGF) (AI094)] [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  140...............ITHSGNYRYNSTESALLTHREKEILNKLRIGASNNEIARSLFIS---------ENTVKTHLYNLFKKIA............................ 199

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.