current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE, from PDB0516

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQYPSFQAGRGLast
1 -110.000d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}  ali model 3D-neighbors follow..  99  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTLYPSFQAGRG 261
2 -93.600d3oida1 c.2.1.0 (A:3-250) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  28  1.....QNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNG-GGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL......... 246
3 -91.600d4iina1 c.2.1.0 (A:1-247) automated matches {Helicobacter pylori [TaxId: 85962]}  ali model 3D-neighbors follow..  37  2...QFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSR-FGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANL--KDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM......... 247
4 -90.200d4nima_ c.2.1.0 (A:) automated matches {Brucella melitensis [TaxId: 546272]}  ali model 3D-neighbors follow..  27  2...QLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIQREANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWG......... 255
5 -89.900d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}  ali model 3D-neighbors follow..  29  4YYYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNR-YGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKI--SEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS.......... 250
6 -89.000d3pk0a1 c.2.1.0 (A:1-258) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  33  3...DLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASG-SGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLEN--GEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL......... 249
7 -88.800d4nbua_ c.2.1.0 (A:) automated matches {Bacillus sp. [TaxId: 161544]}  ali model 3D-neighbors follow..  35  1..SRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN-----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQG-KGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEV--PEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM......... 242
8 -88.700d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  34  8...RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVI-TPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ......... 252
9 -88.300d4yqya1 c.2.1.0 (A:2-248) automated matches {Sulfitobacter sp. [TaxId: 314267]}  ali model 3D-neighbors follow..  36  1...DLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEG---SSIVGLASQAGRDGGPGASAYGASKGALMTLTRGLAKELGPK-IRVNSLCPGMIDTDFHNIF-TKPEVRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLF......... 246
10 -88.100d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}  ali model 3D-neighbors follow..  30  6...SFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHM--DKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLIW........ 260
11 -87.800d5er6a1 c.2.1.0 (A:1-250) automated matches {Brucella ovis [TaxId: 444178]}  ali model 3D-neighbors follow..  30  2..ELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDI-DGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAK--GNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLA......... 249
12 -87.800d3rwba_ c.2.1.0 (A:) automated matches {Mesorhizobium loti [TaxId: 381]}  ali model 3D-neighbors follow..  31  2..ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINA----EGAKAAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKAS-PHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH........ 247
13 -87.500d3uxya_ c.2.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}  ali model 3D-neighbors follow..  27  1....FEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG------------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAG-GGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV......... 240
14 -87.500d3afma_ c.2.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}  ali model 3D-neighbors follow..  29  1MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAGQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADK--TQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYKH........ 258
15 -87.400d4iuya_ c.2.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 405416]}  ali model 3D-neighbors follow..  31  4...DVKDKYILITGASSGLGHHIAELFAKEGANIVICARRLERLKELESHIKNEYGVQVYTFALDVNDRSAVKDMLSSLEAEGVTIDVLINNAGVSDTKRFLDYNDEDWDKIVDTNLKAPWQCAQEVVQHMIKAERKGSIINITSILSQSTNLGVSPYCASKAGLRHLTEVMAVELARFGINVNAIAPGYMITEINEEYLTS-EVGQQLLKKIPTRKFVEFDDLNGPLLLLASQAGQGITGIEIKVDGGHSAAP....... 253
16 -87.100d4n5ma_ c.2.1.0 (A:) automated matches {Ralstonia eutropha [TaxId: 381666]}  ali model 3D-neighbors follow..  31  1....MTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGW-GRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAI--RQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM......... 245
17 -87.100d4qeca_ c.2.1.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 1282]}  ali model 3D-neighbors follow..  28  2......KKNVLITGGFKGIGKQVALEFLKNDYHVCITS-RYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVS-CGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDSGESEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLS......... 247
18 -87.000d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]}  ali model 3D-neighbors follow..  29  1..KKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDM-NREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-YGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVEKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG............ 260
19 -86.800d4is2a_ c.2.1.0 (A:) automated matches {Clostridium scindens [TaxId: 29347]}  ali model 3D-neighbors follow..  33  4....VQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFG-ETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAK-KGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGN--PPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDG............. 245
20 -86.800d2rhca_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  30  1.....DSEVALVTGATSGIGLEIARRLGKEGLRVFVCAR-GEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKA-MLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVRETEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGNY........ 257
21 -86.700d3i4fa_ c.2.1.0 (A:) automated matches {Bacillus thuringiensis [TaxId: 527023]}  ali model 3D-neighbors follow..  27  3.......RHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNF-GRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT--IQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV......... 248
22 -86.700d3o38a_ c.2.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  31  15....LKGKVVLVTAAATGIGSTTARRALLEGADVVISDY-HERRLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKT-SSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.......... 261
23 -86.400d4e6pa_ c.2.1.2 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}  ali model 3D-neighbors follow..  28  1..KRLEGKSALITGSARGIGRAFAEAYVREGATVAIADI-DIERARQAAAEI---GPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGRGGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVRPRGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNWM......... 255
24 -86.300d2zata_ c.2.1.0 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors follow..  28  1..KPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSR-KQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRG-GGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTAS......... 249
25 -86.200d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  33  1......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADY-NDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVF......... 254
26 -86.000d3awda_ c.2.1.0 (A:) automated matches {Gluconobacter oxydans [TaxId: 442]}  ali model 3D-neighbors follow..  29  7...RLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADL-DEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICSEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQK-QGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEKPELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTVW........ 257
27 -85.700d3r1ia_ c.2.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  36  7...DLSGKRALITGASTGIGKKVALAYAEAGAQVAVAAR-HSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPL---ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC......... 253
28 -85.600d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}  ali model 3D-neighbors follow..  37  2...RLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREE----RLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLEE---GGSLVLTGSVAG-LGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGL--PPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI......... 240
29 -84.500d4onea_ c.2.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}  ali model 3D-neighbors follow..  24  1...SRQRPVALVTGGRRGIGLGIARALAAKGFDLAITDRES---DEAVIHELRGLGGKVAFFKSDLAAVKTHEATVFAVLDAFGGIDCLVNNAGMVERGDFLALKPENFDTIMDVNLRGTVFFTQAVVKAMLAADEVRSIVTISSVSSVMTSPERLDYCISKAGLTAFVQGLALRLAEARIGVFEVRPGIIRTDMTAKVAARYDAL--EGGLVPMKRWGEASDVGAIVAGLAGGDFIFATGSAIHADGGLSI......... 250
30 -84.400d4gh5a_ c.2.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}  ali model 3D-neighbors follow..  32  1..NRLKNEVIAITGGGAGIGLAIASAALREGAKVALI---DQGLAERSAAMLSTGGAVAKGFGADVTKAADITAAITSAEQTIGSLTGLVNNAGIAGFGSVHDADAAAWDRIMAVNVTGTFLASKAALAGMLERH-KGTIVNFGSVAGLVGIPTMAAYCAAKGAIVNLTRQMAADYSGRGVRVNAVCPGTVTSTGMGQQLTSPEVQARRLAKYPIGRFGTPEDIAEAVIFLLSDQAAFVTGAAFAVDGGMT.......... 251
31 -84.100d4nbra1 c.2.1.0 (A:1-265) automated matches {Brucella abortus [TaxId: 262698]}  ali model 3D-neighbors follow..  33  13LRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEAR-RGWIVNTSSVAGKTYSPVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGV--APEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYM......... 264
32 -83.900d3wtba1 c.2.1.0 (A:1-243) automated matches {Gluconobacter oxydans [TaxId: 290633]}  ali model 3D-neighbors follow..  30  1....MTHRVALITGGSRGIGAAIALKLAQDGFDIAITYARNEKAAQKVVSEVEALGRKAVAVQADGGSTDGNIAAITKTHEAFGRLDALVCNAGIYPYGPIAQMTVTQIEEVLNLNLRAAMVETVEALKYMKT---GGRLIYIGSAFGEAPFPGISLYAATKAGLIGFTKGVARDLGPQGITANVVEPGPIATDLNPE---DGAAAAVIRKFTATESYGKVNDIARTVSFLASPDASYITGASILVDGGLV.......... 242
33 -83.000d3lf1a_ c.2.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}  ali model 3D-neighbors follow..  24  2...DLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCAR-DGERLRAAESALRQRGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRA-DAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREEREARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGGLSRH........ 261
34 -83.000d4urfa_ c.2.1.0 (A:) automated matches {Aromatoleum aromaticum [TaxId: 76114]}  ali model 3D-neighbors follow..  36  2...LLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDI-SDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGETPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETG-GGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNV--PLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLA......... 247
35 -82.900d3ucxa_ c.2.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  27  3....LTDKVVVISGVGPALGTTLARRCAEQGADLVLAAR-TVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVPSKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEES--KGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEHEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCGEYK......... 257
36 -82.800d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  30  4...PFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK------------GLFGVEVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNK-FGRMIFIGSVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRAL--DERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM......... 237
37 -82.700d3v8ba_ c.2.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}  ali model 3D-neighbors follow..  29  1.....PSPVALITGAGSGIGRATALALAADGVTVGA-LGRTRTEVEEVADEIVGAGGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGINGVAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRG-GGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEETAIQVPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGGQGL......... 255
38 -82.600d2fwmx_ c.2.1.0 (X:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  26  2...DFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQA-----------FTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQR-GGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTL......... 246
39 -82.300d1zmta_ c.2.1.2 (A:) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  18  1.......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDE-------LEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRK-SGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM......... 244
40 -82.100d4o6va_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]}  ali model 3D-neighbors follow..  31  2......QKVAIITAGGSGMGAASARRLAQDGFAVAILSSS--GKGEALAKELGGIG-----VTGSNQSNDDLQKLVDQTLEKWGRIDVLVNSAGHGPRAPILEITDEDWHKGMDTYFLNAVRPARLVVPAMQKQK-SGVIINISTAWAFEPSAMFPTSAVFRAGLASFTKIFADTYAAENIRMNNVLPGWIDSLPT---------TEERRESVPMQRYGKSEEIAATVSFLASDGAAYITGQNLRVDGGLTR......... 230
41 -81.800d4gkba_ c.2.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 395019]}  ali model 3D-neighbors follow..  26  1MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVV--FARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVN-DGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHL--KATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIDPEAKLAEIAAKVPLGRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTH......... 252
42 -81.800d4imra1 c.2.1.0 (A:1-253) automated matches {Agrobacterium fabrum [TaxId: 176299]}  ali model 3D-neighbors follow..  25  8...GLRGRTALVTGSSRGIGAAIAEGLAGAGAHVILHGV-KPGSTAAVQQRIIASGGTAQELAGDLSEAGAGTDLIER-AEAIAPVDILVINASAQINATLSALTPNDLAFQLAVNLGSTVDMLQSALPKMVARK-WGRVVSIGSINQLRPKSVVTAYAATKAAQHNLIQSQARDFAGDNVLLNTLAPGLVDTDRNADRRDPEGWDEYVRTLNWMGRAGRPEEMVGAALFLASEACSFMTGETIFLTGGY........... 253
43 -81.700d4e4ya1 c.2.1.0 (A:1-241) automated matches {Francisella tularensis [TaxId: 177416]}  ali model 3D-neighbors follow..  24  2.......ANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQSFS----------AENLKFIKADLTKQQDITNVLDII--KNVSFDGIFLNAGILIKGSIFDIDIESIKKVLDLNVWSSIYFIKGLENNL---KVGASIVFNGSDQCFIAKPNSFAYTLSKGAIAQMTKSLALDLAKYQIRVNTVCPGTVDTDLYRNLIQKDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDKSKFMTGGLIPIDGGYTA......... 240
44 -81.500d3n74a_ c.2.1.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]}  ali model 3D-neighbors follow..  36  2...SLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIV---DKAGAERVAGEI---GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGKPQNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGAKCVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFMDSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSI......... 252
45 -81.400d4dqxa1 c.2.1.0 (A:23-276) automated matches {Rhizobium etli [TaxId: 347834]}  ali model 3D-neighbors follow..  32  2...DLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVA---NEDAAVRVANEI---GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNG-GGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSI......... 249
46 -81.300d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  29  1..TRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGR-HAERLEETRQQILAAGVNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGASQSKTGTAQSIESYDATLNLNLRSVIALTKKAVPHLSSTK--GEIVNISSIAGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFGSAMGMPEETMATMKECVPAGVMGQPQDIAEVIAFLADRKSSYIIGHQLVVDGGSSL......... 263
47 -81.100d1zmoa_ c.2.1.0 (A:) automated matches {Arthrobacter sp. [TaxId: 168809]}  ali model 3D-neighbors follow..  22  2........IALVTHARHFAGPAAVEALTQDGYTVVCHDASFADAAERQRFESENPGTIALA-------EQKPERLVDATLQHGEAIDTIVSNDYIPRPMNRLPLSEADIRQMFEALSIFPILLLQSAIAPLRAAG-GASVIFITSSVGKKPLAYNPLYGPARAATVALVESAAKTLSRDGILLYAIGPNFFNNPTYFPTSDNPELRERVDRDVPLGRLGRPDEMGALITFLASRRAAPIVGQFFAFTGGYL.......... 242
48 -80.200d4iqga1 c.2.1.0 (A:2-248) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  36  1......SKVVLITGGSRGIGAASALLAARQGYAVAVNYASNSAAADEVVRQIREAGGQALAVQADVAKEREVLAMFETVDAQLGRLSALVNNAGVVDQTRVDGITLERLQRMFEINVFGSFLCAREAVKRMSTRGSGGSIVNVSSAAARLGSPGYVDYAAAKGAIDTFTLGLAKEVATEGIRVNAVRPGIIETDIHASG-GLPNRARDVAPQVPMQRAGTAREVAEAIVWLLGDQASYTTGALLDVTGG............ 246
49 -79.800d3d3wa_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVA-----VSRTQADLDSLVRECPGIEPVCVDLGDWEAT----ERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFW.......... 242
50 -79.500d2x9ga_ c.2.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 5702]}  ali model 3D-neighbors follow..  26  1.....EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKESNTAVVCQADLTNSNSCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDVAELIGTNAIAPFLLTMSFAQRQKGTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVA-----GEEEKDKWRRKVPLGREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA...... 267
51 -79.100d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]}  ali model 3D-neighbors follow..  32  1...RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSL----SSEGLEASKAAVLETAAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQG-SGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQS.......... 255
52 -78.600d3un1a1 c.2.1.0 (A:0-236) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}  ali model 3D-neighbors follow..  28  2...RNQQKVVVITGASQGIGAGLVRAYRDRNYRVVATSRSIKPSA----------DPDIHTVAGDISKPETADRIVREGIERFGRIDSLVNNAGVFLAKPFVEMTQEDYDHNLGVNVAGFFHITQRAAAEMLKQG-SGHIVSITTSLVDQPMVGMPSALASKGGLNAVTRSLAMEFSRSGVRVNAVSPGVIKTPMH-----PAETHSTLAGLHPVGRMGEIRDVVDAVLYL--EHAGFITGEILHVDGGQNA......... 234
53 -78.100d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}  ali model 3D-neighbors follow..  31  5...NLEGCTALVTGGSRGIGYGIVEELASLGASVYTC-SRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASE-RGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPEQKNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANCGF..... 259
54 -77.700d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  10....LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASR-KLERLKSAADELQAKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEH-GGSIVNI-IVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLY........ 262
55 -77.600d2dtxa1 c.2.1.0 (A:2-255) automated matches {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  33  2..SDLRDKVVIVTGASMGIGRAIAERFVDEGSKVID------------LSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSR-DPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAP-LLRCNAVCPATIDTPLVRKAAEIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSI......... 246
56 -77.500d3u49a1 c.2.1.0 (A:2-259) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  28  1.....SKRTAFVMGASQGIGKAIALKLADQHFSLVINSR-NLDNIESVKEDILAKHPEAIVLAGDMSDQHTRAGIFQKIESQCGRLDVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDAIKRASSLMKQNEF-GRIINIVGNLWKEPGANMFTNSMMNAALINASKNISIQLAPHNITVNCLNPGFIATDRYHQFVENQKAEEQIASGIPMKRVGSAEETAALAAFLASEEASYITGQQISADGGSMK......... 256
57 -77.400d3gdfa_ c.2.1.0 (A:) automated matches {Cladosporium herbarum [TaxId: 29918]}  ali model 3D-neighbors follow..  32  17...SLKGKVVVVTGASKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERG-TGSLVITASMSGHIANQEQTSYNVAKAGCIHMARSLANEWR-DFARVNSISPGYIDTGLSDFV--PKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTT......... 266
58 -76.900d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  35  2..TRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVI-----CDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQ--GNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELADPRASIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGGAEL......... 248
59 -76.900d3tzqa_ c.2.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}  ali model 3D-neighbors follow..  28  1..AELENKVAIITGACGGIGLETSRVLARAGARVVL----ADLPETDLAGAAASVGRGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHSADMLVTQMTVDVWDDTFTVNARGTMLMCKYAIPRLISAG-GGAIVNISSATAHAAYDMSTAYACTKAAIETLTRYVATQYGRHGVRCNAIAPGLVRTPRLEVGL-PQPIVDIFATHHLAGRIGEPHEIAELVCFLASDRAAFITGQVIAADSGLLAH........ 247
60 -76.800d3is3a_ c.2.1.0 (A:) automated matches {Cochliobolus lunatus [TaxId: 5503]}  ali model 3D-neighbors follow..  29  2IPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHL---TEGGRIVLTSSTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA.......... 260
61 -76.600d1zk4a_ c.2.1.2 (A:) automated matches {Lactobacillus brevis [TaxId: 1580]}  ali model 3D-neighbors follow..  33  3...RLDGKVAIITGGTLGIGLAIATKFVEEGAKVMIT---HSDVGEKAAKSVGT-PDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDL-PGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYT.......... 249
62 -76.300d3ksua_ c.2.1.0 (A:) automated matches {Oenococcus oeni [TaxId: 203123]}  ali model 3D-neighbors follow..  27  4..HDLKNKVIVIAGGIKNLGALTAKTFALESVNLVLHYHKDSDTANKLKDELEDQGAKVALYQSDLSNEEEVAKLFDFAEKEFGKVDIAINTVGKVLKKPIVETSEAEFDAMDTINNKVAYFFIKQAAKHMNP---NGHIITIATSLLAAYTGFYSTYAGNKAPVEHYTRAASKELMKQQISVNAIAPGPMDTSFFYG--ETKESTAFHKSQAMGNQLTKIEDIAPIIKFLTTD-GWWINGQTIFANGGYTT......... 250
63 -76.200d4zd6a_ c.2.1.0 (A:) automated matches {Corynebacterium sp. [TaxId: 1720]}  ali model 3D-neighbors follow..  22  3...RLAGKRVLLTNADAYMGEATVQVFEEEGAEVIAD-------------------------HTDLTKVGAAEEVV----ERAGHIDVLVANFAVDAHVTVLETDEELWQTAYETIVHPLHRICRAVLPQFYERN-KGKIVVYGSAAAMRYQEGALAYSTARFAQRGYVTALGPEAARHNVNVNFIAQHWTQNKEYPERIATDEFKEDMARRVPLGRLATAREDALLALFLASDESDFIVGKSIEFDGGWA.......... 224
64 -75.600d2ekpa_ c.2.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  30  1......ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQ---------SLGAVPLPTDLEK-DDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAG-WGRVLFIGSVTTFTAGGPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY........ 238
65 -74.300d4u8ga_ c.2.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 211110]}  ali model 3D-neighbors follow..  33  10...SLEGKVALITGASYGIGFSIATAFARAGATIVFN-DIKQELVDKGISAYKKLGIKAHGYVCDVTDEDGINEMVDKISQDVGVIDILVNNAGIIKRTPMLEMSAADFRQVIDIDLNAPFIVSKAVLPGMIQKG-HGKIINICAMMSELGRETVAAYAAAKGGLKMLTKNIASEYGSANIQCNGIGPGYIATPQTAPLRERQDDGSRIIAKTPAARWGEAEDLGAPAIFLASDASNFINGHILYVDGGILAY........ 263
66 -73.700d3icca1 c.2.1.0 (A:1-252) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  32  2....LKGKVALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSAFSIGANLESLHGVEALYSSLDNELTKFDILINNAGIGPGAFIEETTEQFFDRMVSVNAKAPFFIIQQALSRL---RDNSRIINISSAATRISLPDFIAYSMTKGAINTMTFTLAKQLGARGITVNAILPGFVKTDMNAELLSDPMMKQYATTISAFNRLGEVEDIADTAAFLASPDSRWVTGQLIDVSGGSCL......... 252
67 -73.600d4x54a_ c.2.1.0 (A:) automated matches {Brucella ovis [TaxId: 444178]}  ali model 3D-neighbors follow..  26  2.......KTLVLTGASRGIGHATVKRFSLAGWRVITCS------RQDFSENCPWPAGPEDHIKVDLSDPEDIGKAIAEIRRRLSKLHALVNNAGISPKAESIETPMAVWRDVFQVNFMAPIMLARGLFKEL--EAAQGSVVNVTSIAGSRVHPAGTAYATSKAALAALTREMASDFGPYGIRVNAIAPGEIDTAILSPG------TDKLVEQLPMRRLGKTSEVAETIYFLCTETSSYVTGSEIHIN.............. 238
68 -73.300d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}  ali model 3D-neighbors follow..  29  3...RLQGKVALVTGGASGVGLEVVKLLLGEGAKVAFS---NEAAGQQLAAEL---GERSMFVRHDVSSEADWTLVMAAVQRRLGTLNVLVNNAGILLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAM--KETGGSIINMASVSSWLPIEQYAGYSASKAAVSALTRAAALSCRKQGIRVNSIHPDGIYTPMMQASLPKKEMVLHDPKLNRAGRAYMPERIAQLVLFLASDESSVMSGSELHADNSIL.......... 249
69 -73.000d3zv4a_ c.2.1.2 (A:) automated matches {Pandoraea pnomenusa [TaxId: 93220]}  ali model 3D-neighbors follow..  28  2...KLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKS----AERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDFDDIFHVNVKGYIHAVKACLPALVSSR--GSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAP-HVRVNGVAPGGMNTDLRGPSSSSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSPATGALLNYDGGMGV......... 257
70 -73.000d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1....VNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDW-NLEAGVQCKAALHEQPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNE--------KNWEKTLQINLVSVISGTYLGLDYMSKQNEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAILESIEKEEEYKDHIKDMIKYYGILDPPLIANGLITLIEDDA--LNGAIMKITTSKGIH........ 250
71 -72.900d5bt9a1 c.2.1.0 (A:9-254) automated matches {Brucella ovis [TaxId: 1293916]}  ali model 3D-neighbors follow..  25  2....VANCPVLVTGGARRIGKAIVEDLASHGFPVAIHCNRSLDEGEAIANRINDSGGNACVVQADLE--GDVRGLVKQASDRIGPIRLLVNNASLFQEDKVGALDMALWDRHFAVHLKTPVILAEDMRKALPEDQ-DGLVVNIIDQRVWKLNPQFFSYTLSKTALWNATRTLAQALAPR-IRVNAIAPGPTLPSERQ----RPEDFERQVSKLPLQRAPELPEFGRTVRYFWE--NRSITGQMIALDGGQHL......... 239
72 -72.800d2b4qa_ c.2.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  26  6...SLAGRIALVTGGSRGIGQMIAQGLLEAGARVFIC-ARDAEACADTATRLSAYG-DCQAIPADLSSEAGARRLAQALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASPARVINIGSVAGISAMGEQAAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQALEADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFHL......... 256
73 -72.500d4pcva_ c.2.1.0 (A:) automated matches {Escherichia coli [TaxId: 1116044]}  ali model 3D-neighbors follow..  31  2...AFTGKTVLILGGSRGIGAAIVRRFVTDGANVRFTYAGSKDAAKRLAQET-----GATAVFTDSADRDAV----IDVVRKSGALDILVVNAGIGVFGEALELNADDIDRLFKINIHAPYHASVEAARQM---PEGGRILIIGSVNGDMPVAGMAAYAASKSALQGMARGLARDFGPRGITINVVQPGPIDTDANPA---NGPMRDMLHSLMAIKRHGQPEEVAGMVAWLAGPEASFVTGAMHTI............... 230
74 -71.600d4hp8a_ c.2.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  33  4...SLEGRKALVTGANTGLGQAIAVGLAAAGAEVVC----ARRAPDETLDIIAKDGGNASALLIDFADPLAAKDSFTD-----AGFDILVNNAGIIRRADSVEFSELDWDEVMDVNLKALFFTTQAFAKELLAKGRSGKVVNIASLLSFQGGIRVPSYTAAKHGVAGLTKLLANEWAAKGINVNAIAPGYIETNNTEALRADAARNKAILERIPAGRWGHSEDIAGAAVFLSSAAADYVHGAILNVDGGWL.......... 243
75 -71.000d4trra_ c.2.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}  ali model 3D-neighbors follow..  29  2..SNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIA---NQDGANAVADEINKAGGKAIGVAMDVTNEEAVNTGIDKVAEAFGSVDILVSNAGIQIVNPIENYSFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKISEEEVIKKVMLGNTVDGVFTTVQDVAQTVLFLSAFPSAALTGQSFIVSHGWFM......... 260

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.