current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst QDPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGEKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTELast
1 -60.9005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model  100  1QDPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGEKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTE 154
2 -60.7005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  99  5.DPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTE 157
3 -44.6002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  31  10...LGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNP--CQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKIN-EFQCECPTGFTGHLCQVDLHHILDAQKMVWN........................ 133
4 -44.0004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  16  43NVVALNIKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNTYAVENQSAPWHPGGTWVAGTMTYAGEGPIGFKSQQADGGVYAGSSAPWHNGGVWVINGNMTYAGEGPIGFKGNSVAGNNYAELYITSGDNGNTFHGSMTYSGEGPIGFRAMALPQ 279
5 -43.6004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  35  348.MTCADGPCFNGGRCSDSPDGYSCRCPVGYSGFNCEKKIDYCSSSP--CSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVN-DFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQRGHGYVCECARSYGGPNCQ. 497
6 -42.2004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  40  1.....................................DVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIG-EFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQ. 115
7 -40.0001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  21  43.DQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSL-DNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRK-RSVAQATSSSGEAPDSTWKPYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQ 194
8 -39.9004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  40  1.DICDPNPCENGGICLPGLGSFSCECPDGFTDPNCSSVVEVASDEE----------------------------EPTSAGPCTPNPCHNGGTCEISEAIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQ. 132
9 -39.8001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  14  11.RGNLERECIEEKCSFEEAREVFENTEKTNEFWKQYVDGDQCEPNP--CLNGGLCKDDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGADS-KVLCSCTTGYRLAPDQKSCKPAVPFPCGRVSVSHSPTTLTR.............. 146
10 -38.0004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  17  37.....DIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTGTSAPIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDTYSGSAAPWHSGGVWVLSGTMTYNGEGPIGFRGTLTSPDTYTVENQWSSDGGKTLAGTMIYNGEGPIGFRAR.... 265
11 -35.4001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  19  19EEQCSFEEAREIF----------KDAERTKLFWISYSDGDQCASSP--CQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPIL----EKRNASKPQG........ 151
12 -34.9004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  26  166NKFCRPRDDFFGHYACD--QNGNKTCMEGWMGPECNRAI----CRQGCSPKHGSCKL---PGDCRCQYGWQGLYCD----KCIPHPGCVHGICNE----PWQCLCETNWGGQLCDKDLNYCTHQPCLNGGTCSNGPDKYQCSCPEGYSGPNCE. 303
13 -34.1002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  26  25NKFCRPRDDFFGHYACD--QNGNKTCMEGWMGPECNRAI----CRQGCSPKHGSCKL---PGDCRCQYGWQGLYCD----KCIPHPGCVHGICNE----PWQCLCETNWGGQLCDKDLNYCGTHPCLNGGTCSNGPDKYQCSCPEGYSGPNCE. 162
14 -33.7004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  22  127..GKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLC----KKRDDHFGHYECQP---DGSPSCLPGWTGKYCDQPI--CLSGCHEQNGYCSK----PDECNCRPGWQGPLC----NECIPHKGCRHGTCT---IPWQCACDEGWGGLFCDQ 258
15 -30.6001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  19  15.EHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRS....................................................... 112
16 -29.4001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  22  1..................ANSFLEEMKKGHLERECMEET--CSYEE--AREVFEDSDKTNEFWNKYKDG----------DQCETSPCQNQGKCKDGLG-EYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGK 122
17 -29.3001fax_L mol:protein length:96 FACTOR XA  ali model follow..  26  5.DQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSL-DNGDCDQFCHEEQASVVCSCARGYTLADNGKACIPTGPYPCGKQTLE............................................................. 95
18 -26.2002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  36  147QQAECPGGCRNGGFCNE---RRICECPDGFHGPHCEKAL------TPRCMNGGLCVT---PGFCICPPGFYGVNCDKAN---CSTTCFNGGTCFYPG----KCICPPGLEGEQCEISK---CPQPCRNGGKCI---GKSKCKCSKGYQGDLCSK 276
19 -25.4002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  24  8.....HDALKGPNVCGS---RYNAYCCPGWKTLPGGNQCIVPIC-RHSCGDGFCSRPN----MCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDD-----HCLCQKGYIGTHCGQPV---CESGCLNGGRCV---APNRCACTYGFTGPQCE. 136
20 -25.2001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  20  1..................ANSFLEEVKQGNLER--------------ECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIG-DYTCTCAEGFEGKNCEFSTR................................... 86
21 -25.2001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  19  5.SAVTVDTICKNGQLVQMSNHFKCMCNEGLVENTCE-EKNECKKETLGKA-ENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESGECIVSEIQSAGCSCAIGKVEKKCKTGETACQLKCNTDNEVCKNVEGVYKCQCMEGFT...... 169
22 -23.7004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  32  146............................................................SYRVVCSDNYYGDSCSRLCKK--RDDHFGHYEC----QPDGSPSCLPGWTGKYCDQPI--CLSGCHEQNGYCSK---PDECNCRPGWQGPLCNE 228
23 -23.5001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  23  1............................................................SYQVICRDEKTQMIYQ--QHQSWLRPVLRSNRV-------EYCWCNSGRAQ-CHSVPVKSCSEPRCFNGGTCQQALSDFVCQCPEGFAGKSCE. 85
24 -23.4004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  21  2..........................................................................SEKCFEPQLLRFFHKNEIWYRT-EQAAVARCQCKGPDAHCQLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCD. 80
25 -20.9004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  28  189.........................CEAQKWGPECN---HLCTA----CMNNGVCHEDTG--ECICPPGFMGRTCEKACELCKQEGCKSYVFCLPDPYG---CSCATGWKGLQCNEACHDCKLRSCNNGEMCDRFQG---CLCSPGWQGLQCER 320
26 -20.8001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  22  4.NECLDPTTCISGNCVNTPGSYICDCPPDFE---LNPTRVGCVDRSGNCYLDIRPRGDNGDTACSNEIGVSKASCCCSLGKAWGTPCEMCPAVNTS-EYKILCPGGEGFRTVILE-DIDECQELPLCQGGKCINTFGSFQCRCPTGYYTRVCD. 162
27 -19.5001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  24  4.DGCLSNPCFPGAQCSSFPGSWSCFCPVGFLGNGTHEDLDECALVPDSTSKVPRCVNTQPGFHCPCPPRYRGNQPVEPENPCKTHNCHKHAECIYLSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQE 182
28 -18.8002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  28  5.DECESSPCIN-GVCKNSPGSFICECSSESTLDPTKTICIE--------TIKGTCWQTVIDGRCEININGLKSQCCSSLGAAWGSPCTLC---------QVDPICGKGYSGTQCE-DIDECEVFP--KNGLCVNTRGSFKCQCPSGMTGRIC.. 146
29 -18.3002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  26  3.RGC-ARWCPQDSSCV---NATACRCNPGFSSFS--DDINECATLSKSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECSS--------------------------GQHQCDSSTVCFNTVGSYSCRCRPGWK...... 128
30 -18.3001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  31  1.......................................................................GTSHLVKCAEKEKTFCVNGGECFMVKDSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELY...................... 65
31 -17.7003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  22  6.SPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNEHPERTDGCQH--FCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVEKRAPDLQDLPWQVKLTNSEGKDFCGGVI--IRENFVLTTAKCSLLHRNIT.............. 144
32 -16.7001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  44  4.DQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA.............................................................................................................. 46
33 -16.6001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  15  2..................................PL-AQQTCANNRHQCSVHAECRDYATGFCCRCVANYTGNQCVAEGSP-GKVKGRIFVGSSQV-PVVFENTDLHSYVVMRSYTAISTIPETYSLLPLAPIGGIIGWMFAVEQDGNGFSITG 131
34 -16.2002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  18  76...............................................RSLDKGIMADPT---VNVPLLGTVPHKASVVQVGF---PCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAQAECPGGCRNGGFCN---ERRICECPDGFHGPHCEG 180
35 -15.7003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  23  147..................................................................KEGFQG---------CLASVDLNGRLPDLISDALFC----NGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCND 222
36 -15.5004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  40  2.................................................................................................................DIVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCE. 41
37 -15.3005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  23  137.GDCDGVQINVPITFQVKVTATECIQEQSFVIRQCECRCRDQSRDRSLCHGKGFLECG----ICRCDTGYIGKNCECQTQGRSSQECSGLGDCV-------QCLCHTSIYGQYCECDTINCERYNGPGRGLCFCG----KCRCHPGFEGSACQ. 313
38 -15.2004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  16  297QDFRSSTCAELTTDCVRPMPDHETKCPPREPLKNVRKPMNARASLS--NATAEQCGQRLMLSSADGSSLSSQVRGYHWATFVATDCNMGRGKCF-FYSTVPECLIHAIDPDSIAVLPEDKCVSVDCGAHGTCDV--ATGKCVCEPGFTGERCDA 502
39 -15.0004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  26  455..DCQKEVEVNSSKCHHGNGSFQCACHPGHMGPRCECGEDMLSTDHPSCSGRGDCY------QCICHLSIYGPYCQCDNFSCVRHKCGGNGDCD-------ECVCRSGWTGEYCNTSTDSCVSEDCSGRGDCV------KCVCNPGASGPTCER 616
40 -14.6005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  22  433....DRSLCHGKGFLECG----ICRCDTGYIGKNCECQTQG-DNNSIICSGLGDCVCG----QCLCHTSIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQRTTEGCLNPRCSGRGRCRCN----VCECHSGYQLPLCQE 592
41 -14.2001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  18  11.HKCIDTNVPENAACYRYLDGEEWRCLLGFKGGKCVPASITCEENNGGCAPEAECTMDKKEVECKCTKEGSE.................................................................................. 85
42 -13.8001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  33  2.ASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE.................................................................................................................. 40
43 -13.4001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  20  1...........................................................................NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQETCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSGIFCSS 94
44 -13.2004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  26  436..ACQAQAEPNSHRCNNGNGTFECRCGPGWLGSQCESQQDECREGQPVCSQRGECL------QCVCHSSITGKYCECDDFSCVRYKCSGHGQCS-------DCLCDSDWTGYYCNTRTDTCMSSNCSGRGKCE------SCVCQPGSYGDTCEK 600
45 -13.1002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  19  6..KCCDNIKRLPTKPDPP----QWRCNDELEPSQCTAACKSCREAPGPFPG-----------KLICEDIYWGADPGPFCTPRPWGDCCDKAFCNKMNPPTCRCM-----EVKECADACKDCQRVESSEPPRYV---------CKDRFTG..... 124
46 -12.9001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  38  4.DECRISP--GRGQCVNTPGDFECKCDEGYEMKNCM-DIDECQRDPLLCRG-GVCHNTEGSYRCECPPGHQ................................................................................... 77
47 -12.9003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  16  296..RCKCNL--HATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGAANACIPSISSIGTNVCDNELLHCQNGGTCHNNVR---------CLCPAAYTGILCE----KLR---CEEAGSCGSDSG--QGAPPHG........ 419
48 -12.9001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  32  6.DECKEPDVCKHGQCINTDGSYRCECPFGYIGNECV-DTDECSVGNPCG--NGTCKNVIGGFECTCEEGFEMMTCE.............................................................................. 82
49 -12.8001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  21  1.........................................................................NSYPGCPSSYDGYCLNGGVCMHIESDSYTCNCVIGYSGDRCQTRDLRWWEL.............................. 52
50 -12.7002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  16  6.HTCIDTNVPDNAACYRYLGTEEWRCLLTFKGGKCPASNVTCKDNNGGCAPEAECKMTSNKIVCKCTKEGSE.................................................................................. 81
51 -12.6003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  17  2.SACELPECQGNKVCSLQ----CNNHACGWDGGDCSLNFNDPWKN---------------TQSLQCWKYFSDGHCD---SQCNSAGCLFDG-----------FDCQRAEGQCNPLYD----YCKDHFSDGHCDQG----CNSAECEWDGLDCAE 118
52 -12.5001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  20  1...........................................................................NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQETCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSGIFCS. 93
53 -12.5001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  18  5.HRCIDTNVPENAACYRYLGTEEWRCLLYFKAGKCPAPNMTCKDKNGGCAPEAECKMNKNEIVCKCTKEGSGVFCS.............................................................................. 89
54 -12.4002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  20  1...............MKPMSDYDIPTTENLYFQGAM-GTNECLDNNGGCSH--VCNDLKIGYECLCPDGFQ---LVAQRRCEDIDECQDPDTCSQLLEGGYKCQCEEGFQ............................................ 92
55 -12.3004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  22  433....DRSLCHGKGFLECG----ICRCDTGYIGKNCECQTQG-DNNSIICSGLGDCVCG----QCLCHTSIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQRTTEGCLNPRCSGRGRCRCN----VCECHSGYQLPLCQE 592
56 -12.1002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  30  186..........................................................................CRCRDQSRDRSLCHGKGFLE-------ICRCDTGYIGKNCECQTQSCRKDNCSGLGDCVCG----QCLCHTSIYGQYCE. 274
57 -11.9001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  26  1................................................................................................................NSYPGCPSSYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCEH 44
58 -11.7002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  30  1....................................SDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAV------------INDLHGEGPPPPVPPAQHPNPCPPGYE............................................ 62
59 -11.6004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  13  477EGSYVAEEAGCPLSCAVSKRRLECCGGLGSPTGRCE--------------RQGDGKGITRNFS----------TCSPSTKTCPDGHC-------DVVETQDINICPQDCLRGSIGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEIQDPLCDE 604
60 -11.5003cfw_A mol:protein length:164 L-selectin  ali model follow..  26  104............................................................................................................WNDDACHKLTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQF 155
61 -11.3002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  20  12....................................................................................RDIPKNAGCFRDDDGTEEWRCLLGYKKPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPGVFCSS 97
62 -11.3003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  21  148...................................................................EPFKG---------WIRDVRVNSSL-VDSGEVKLDDEPPNSGGGSPCEAG-EEGEGGVCLNGGVCSVVDDQAVCDCSTGFRGKDCSQ 227
63 -11.3004ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  16  147.NNCAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRRPNCLSLQDSCKTNYICRSRLADFFTNCQPESRSVSCLLAYSGLIGTVMTPNYVDSSSLSVAPWCDCSSGNDLEDCLKFLNFFKDNTCLKNAI....................... 337
64 -11.2002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  24  12....................................................................................RDIPKNAGCFRDDDGTKEWRCLLGYKKGEGNNNNPTCDINNCDPTASCQNAESTIICTCKEPTPNAYYE. 91
65 -11.0005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  37  1KNPCCSHPCQNRGVCMSGFDQYKCDCTTGFYGENCST..................................................................................................................... 39
66 -10.8003ltf_D mol:protein length:58 Protein spitz  ali model follow..  21  8PETFDAWYCLNDAHCIADLPVYSCECAIGFMGQRCEYKEIDNTYLPK........................................................................................................... 58
67 -10.8002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  15  303....................................................VSWENTRTKESCQAIKEYMDTNVTSGALLCSQALCSGHGRCVRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCER 412
68 -10.8004bxs_A mol:protein length:423 FACTOR X-LIKE PROTEASE  ali model follow..  21  48.DQCSSNPCHYRGICKDGIGSYTCTCLSGYEGKNCERVLYKCRVDNGNCWH--FCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKTRNKREANLPD-FVQSQNATLLKKSDNPSPDIRIVNGMDCKLGECPWQAALVDEKEGVFC.. 196
69 -10.6004aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  24  313.NACKKCNCNEHSSTGNVSGGVCDNCQHNTMGRNCEQLCEPCTCDPAGSENGGICDGYTDFSQCRCKLHVEGERCDVDPYGCKSCACNPLGTIPGGNSETGYCYCKRLVTGQRCDQDLDGCRPCDCDLGGALNNSCSEDSCSCLPHMIGRQCNE 525
70 -10.5003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  19  2....................................EPVDPCFRANC---EYQCQPLNQTSYLCVCAEGFA--PIPHEPHRCQLFCNQTACPADCDPNTQASCECPEGYDGFICTDIDECENGGFCSG--VCHNLPGTFECICGPDSA...... 109
71 -10.4002ddu_A mol:protein length:387 reelin  ali model follow..  13  108..........DAGM---SWFLVKEGCFPASAGKGCEGNSRELSEPTVTIAIPRSLASSKTRFRWIQESSSQKNVPPFGLDGVYISECSGHGDCISG-----VCFCDLGYTAAQGTC---SNTPNHSEMFDRFEGKLSPLWYKITGGQVGTGCG. 257
72 -10.4005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  21  1....................GPAMSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGY------------------------CLHGQCIYLVDMSQNYCRCEVGYTGVRCE....................................... 71
73 -10.3001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  35  33..............................................................................VNPCCYYPCQHQGICVRFGLDRYQCDCTTGYSGPNCTIP..................................... 72
74 -10.2005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  11  361......................DSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTAT----ECIQEQSFVIRECRCRDQSRDRSLCHGKGFLE-------ICRCDTGYIGKNCEPAALQTLFQGAQGKKKLQA-----KKNAQLKWKLQALK. 498
75 -10.1004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  21  5...........................................SEEPRCPRAA-CQAKRGD---RCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLNSRCDPACSSPACLYDNFDCHAGGHFADGRCDQGCNTEEC----GWDGLDCAS 125

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.