current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5f1a_A mol:protein length:553 Prostaglandin G/H synthase 2, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550
# Score Template Links and tools%idFirst KNPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDLast
1 -168.0005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model  100  1KNPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPD 553
2 -157.0001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  63  34.NPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATF-IRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYAQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHFHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD 584
3 -144.0003qh0_A mol:protein length:610 Prostaglandin G/H synthase 2  ali model follow..  88  19.NPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQD 570
4 -101.0004hhr_A mol:protein length:652 Alpha-dioxygenase  ali model follow..  20  25..................................DFHEIYARMSLLDRFLLLIVHGVDKMVPHKLPVFLGLTYLEVRRHLHQQYNLLNVGQTPTGIRFDPANYPYRTADGKFNDSFFGRNCPPVDQKS--------KLRRPDPMVVATKLLGRKKFIDTGKQFNMIAASWIQFMIHDWIDHFFEIKTGSQNIRTPWWDSSVIYGSNSKTLDRVRTYKDGKLKISEETGLLLHD----------------EDGLAISGDIR-NSWAGVSALQALFIKEHNAVCDALKDEDDDLEDEDLYRYARLVTSAVVAKIHTIDWTVQLLKTDTLLAGMRANWYPQNHGVPYSLTEDFTSVYRMHSLLPDQLHILDIDDVPGTGRKGEETMSHIGFTKLMVSMGHQASGALELMNQARPDHVDLAALEIYRDRERSVPRYNEFRRSMFMIPITKWEDLTEDEEAIEVLDDVYGDVEELDLLVGLMAEKKIKGFAISETAFYIFLIMATRRLEADRFFTSDF-NETIYTKK-GLEWVNTTESLKDVIDR............. 608
5 -98.2004kvj_A mol:protein length:621 Fatty acid alpha-oxidase  ali model follow..  17  3...........................GSGSVHPDLRDVFSKMSFFDKIGFLFIHAFDKRNLHKVPVPIGLLYLNTRRTLLEKYNLLAVGRSSHGALFDPKEFLYRTEDGKYNDTFFGRNMEPVDQQ--------DELMSPDPFVVATKLLARREYKDTGKQFNILAAAWIQFMVHDWMDHMEDTGIGHYNIRTAWWDGSAVYGNNEERAEKLRTYVDGKLVI---GDDGLLLHKENG--------------VALSGDIR-NSWAGVSILQALFVKEHNAVCDAIKEEHPNLSDEELYRYAKLVTSAVIAKVHTIDWTVELLKTKTMRAAMRANWYGNNHGVPYSLTEEFTSVYRMHSLIPSTLKLRDPTGQPDAGLKGEEQLSKIGFEKQALSMGYQACGALE-DGTNRSDRIDLAALEVYRDRERSVPRYNEFRRRLFLIPIKSWEDLTSDKDAIETIRAIYGDVEKLDLLVGLMAEKKIKGFAISETAFNIFILMASRRLEADRFFTSN-FNEETYTKK-GMQWVKTTEGLRDVIRHYPEITAKWMKSSS 606
6 -86.0002o86_A mol:protein length:595 Lactoperoxidase  ali model follow..  17  11..............................................................................................PLVKCDENSPYRTITGDCNNRALARWLPAEYEDGLALPFGWNGFRVPLAREVSNKIVGLDEDGVLDQNRSLLFMQWGQIVDHDLDFAYQSLAREQINAVTSFLDASLVYGSEPSLASRLQNLSSPLGLMAV-HGLAYLPFNNRKPSPCEFINTTARVPCFLAGDFRASEQILLATAHTLLLREHNRLARELKKLNPQWDGEKLYQEARKILGAFVQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFT-FAFRFGHMEVPSTVSRLDENYQHTLFFNTWRIIKDGGIDPLVRGLLAKKSKLMNQDKMVTSELFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTNKILAKKLMDLYKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWEN---PGVFTEK-QRDSLQKMSFSRLICDNTHKVPLHAFQANN 571
7 -85.7002ikc_A mol:protein length:595 milk lactoperoxidase  ali model follow..  17  11..............................................................................................PLVKCDENSPYRTITGDCNNRALARWLPAEYEDGLAVPFGWNGFRVPLAREVSNKIVGLDEEGVLDQNRSLLFMQWGQIVDHDLDFAYQSLARDQINSVTSFLDASLVYGSEPSLASRLRNLSSPLGLMAV-HGLAYPPFNNMKPSPCEFINTTARVPCFQAGDSRASEQILLATVHTLLLREHNRLARELKRLNPHWDGEKLYQEARKILGAFIQIITFRDYLPIVLGSEMQKWIPRYQGYNNSVDPRISNVFT-FAFRFGHMEVPSTVSRLDENYQHTLFFNTWRIIKDGGIDPLVRGLLAKKSKLMNQNKMVTSELFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQANKILAKKLLDLYKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWEN---PGVFTEK-QRDSLQKVSFSRLICDNTHKVPLHAFQANN 571
8 -85.6002e9e_A mol:protein length:595 Lactoperoxidase  ali model follow..  18  11..............................................................................................PLVTCDEQSPYRTITGDCNNRALARWLPAEYEDGLAVPFGWNGFRVPLAREVSNKIVGLDEEGVLDQNRSLLFMQWGQIVDHDLDFAYQSLARDQINAVTSFLDASLVYGSEPSLASRLRNLSSPLGLMAV-HGLAYPPFNNVKPSPCEFINTTAHVPCFQAGDSRASEQILLATVHTLLLREHNRLARELKRLNPHWDGEMLYQEARKILGAFIQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFT-FAFRFGHMEVPSTVSRLDENYQHTLFFNTWRIIKDGGIDPLVRGLLAKNSKLMNQNKMVTSELFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQANKVLAKKLLDLYKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWEN---PGVFTEK-QRDSLQKVSFSRLICDNTHKVPLHAFQANN 571
9 -85.4002ips_A mol:protein length:595 Lactoperoxidase  ali model follow..  17  11..............................................................................................PLVKCDENSPYRTITGDCNNRALARWLPAEYEDGLALPFGWNGFRVPLAREVSNKIVGLDEEGVLDQNRSLLFMQWGQIVDHDLDFAYQSLAREQINAVTSFLDASLVYGSEPSLASRLRNLSSPLGLMAV-HGLAYLPFNNKKPSPCEFINTTARVPCFLAGDFRASEQILLATAHTLLLREHNRLARELKKLNPHWNGEKLYQEARKILGAFIQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFT-FAFRFGHMEVPSTVSRLDENYQHTLFFNTWRIIKDGGIDPLVRGLLAKKSKLMNQDKMVTSELFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTNKILAKKLMDLYKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWEN---PGVFTEK-QRDSLQKVSFSRLICDNTHKVPLHAFQANN 571
10 -78.3003f9p_C mol:protein length:467 Myeloperoxidase  ali model follow..  18  43....................................................................................................................................................................................GSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAV-NGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYPTYRSYNDSVDPRIANVFT-NAFRYGHTLIQPFMFRLDNRYQSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWEN---EGVFSMQ-QRQALAQISLPRIICDNTGITTVSKNNI.. 439
11 -21.9003f9p_A mol:protein length:114 Myeloperoxidase  ali model follow..  14  2.................................................................................................TCPEQDKYRTITGMCNNRAFVRWLPAEYEDGFSLPYGWTGFPVALARAVSNEIVRPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVT......................................................................................................................................................................................................................................................................................................................................................................... 113
12 -15.5004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  27  46.QACRTNPCLHGGRCLE-VEGHRLCHCP-VGYTGPFCDV.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 81
13 -14.8001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  30  49.KSCSEPRCFNGGTCQQLYFSDFVCQCP-EGFAGKSCEIDTRAT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 91
14 -14.5004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  42  7.DQCESNPCLNGGSCKD-DINSYECWCP-FGFEGKNCELLE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 44
15 -14.1001fax_L mol:protein length:96 FACTOR XA  ali model follow..  43  5.DQCETSPCQNQGKCKD-GLGEYTCTCL-EGFEGKNCELF................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 41
16 -14.1001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  44  48.DQCEGHPCLNQGHCKD-GIGDYTCTCA-EGFEGKNCEF.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 83
17 -13.2001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  44  4.DQCASSPCQNGGSCKD-QLQSYICFCL-PAFEGRNCET.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 39
18 -13.0001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  32  1TASCQDMSCSKQGECLE-TIGNYTCSCY-PGFYGPECEY.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 37
19 -12.4001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  29  15.EHPCASLCCGHGTCID-GIGSFSCDCR-SGWEGRFCQRE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 51
20 -12.4001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  28  9.AEKEKTFCVNGGECFMSNPSRYLCKCQ-PGFTGARCTE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 49
21 -12.2001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  37  49.DQCEPNPCLNGGLCKD-DINSYECWCQ-VGFEGKNCELD................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 85
22 -11.9001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  36  7.PSSYDGYCLNGGVCMHESLDSYTCNCV-IGYSGDRCQT.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 44
23 -11.8001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  43  48.DQCASSPCQNGGSCKD-QLQSYICFCL-PAFEGRNCETH................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 84
24 -11.8001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  43  48.DQCETSPCQNQGKCKD-GLGEYTCTCL-EGFEGKNCELF................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 84
25 -11.6004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  33  1.DICDPNPCENGGICLPGADGSFSCECP-DGFTDPNCSSV................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 39
26 -11.2002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  44  126.NYCGTHPCLNGGTCSNTGPDKYQCSCP-EGYSGPNCEI.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 163
27 -11.2001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  43  43.DQCETSPCQNQGKCKD-GLGEYTCTCL-EGFEGKNCELF................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 79
28 -11.0005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  37  1QDPCASNPCANGGQCLP-FEASYICHCP-PSFHGPTCRQ.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 37
29 -10.9001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  32  7.PSSYDGYCLNGGVCM-ESLDSYTCNCV-IGYSGDRCEHADLLA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 49
30 -10.8005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  43  83.VPCSPSPCQNGGTCRPTGDVTHECACL-PGFTGQNCEE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 119
31 -10.7003ltf_D mol:protein length:58 Protein spitz  ali model follow..  26  5.YKCDAWYCLNDAHCFAADLPVYSCECA-IGFMGQRCEYKEIDNTY........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 55
32 -10.5004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  33  81.DECASSPCLHNGRCVD-KINEFLCQCP-KGFSGHLCQS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 116
33 -10.4001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  4EHRCIDTNVPENAACYRYLDGTEEWRC-LLYFKEDAGKCVPA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 44
34 -10.4002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  12  5EHTCIDTNVPDNAACYRYLDGTEEWRC-LLTFKEEGGKCVPA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 45
35 -10.0002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  36  84.DECASSPCLHNGRCLD-KINEFQCECP-TGFTGHLCQV.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 119
36 -9.9901n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  10AHKCIDTNVPENAACYRYLDGTEEWRCL-LGFKEVGGKCVPASITCEENNGGCAPEAECTMDD.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 71
37 -9.5205e8d_A mol:protein length:75 Proepiregulin  ali model follow..  21  33.TKC----CLHGQCIYLVDMSQNYCRCE-VGYTGVRCEHFFL............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 75
38 -9.3202m74_A mol:protein length:136 Fibrillin-1  ali model follow..  39  104GQPVCESGCLNGGRCVAPN----RCACT-YGFTGPQCE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 136

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.