current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5e8d_A mol:protein length:75 Proepiregulin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst GPAMSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLLast
1 -39.4005e8d_A mol:protein length:75 Proepiregulin  ali model  100  1GPAMSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL 75
2 -31.6001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  20  12......PQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLS. 79
3 -27.9001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  35  1...........................VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADL 48
4 -27.7001iox_A mol:protein length:50 Betacellulin  ali model follow..  31  2............................KGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDL 48
5 -25.8002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  24  1.......................GSSGSSGKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEK.. 50
6 -25.5001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  37  1...........................VVSHFNDCPLSHDGYCLHGVCMYIEALDKYACNCVVGYIGERCQYRDL 49
7 -24.8001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  41  1.............................NSDSECPLSHDGYCLHGVCMYIEALDKYACNCVVGYIGERCQYRDL 47
8 -21.4003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  27  2............................TSHLVKCAEKEKTFCVNGECFMVKDLSNPSCKCPNEFTGDRCQNYVM 52
9 -20.6001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  41  1.............................NSYPGCPSSYDGYCLNGGCMHIESLDSYTCNCVIGYSGDRCEHADL 47
10 -20.4001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  33  2.................................GAPSSYDGYCLNGGAMHIESLDSYTCNCVIGYSGDRCQTRDL 44
11 -19.2001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  36  1.............................NSYPGCPSSYDGYCLNGGCMHIESLDSYTCNCVIGYSGDRCQTRDL 47
12 -17.5001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  27  2............................TSHLVKCAEKEKTFCVNGGECFLSNPSRYLCKCQPGFTGARCTENVP 52
13 -16.6003ltf_D mol:protein length:58 Protein spitz  ali model follow..  27  1............................TFPTYKCPETFAWYCLNDAHCFIADLPVYSCECAIGFMGQRCEYKEI 51
14 -13.1003cfw_A mol:protein length:164 L-selectin  ali model follow..  19  81......PNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYHGEC--VEIINNYTCNCDVGYYGPQCQFV.. 156
15 -12.2002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  29  155..........................................CRNGGFC----NERRICECPDGFHGPHCEGT.. 181
16 -12.1001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  22  20...SWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEP----CFNGGCQQALYFSDFVCQCPEGFAGKSCE.... 85
17 -12.0004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  20  217PGDCRCQYGWQGLYCDKCIPHPVHGICNEPWQCLCETNWGG-CLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD. 306
18 -12.0004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  18  7.EPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHLEVEGHRLCHCPVGYTGPFCD.... 80
19 -11.6005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  22  255..QCLCHTSDVPGKLIYGQYCEDTINCERYNGQVCGGPGRGLCFCG-----------KCRCHPGFEGSACQ.... 313
20 -11.0003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  24  186................................TTCQED----CSNQGVC-LQQWDGFSCDCSTSFSGPLCND... 222
21 -10.8004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  23  181...PSCLPGWTGKYCDQPICLSGCHYCSKPDECNCRPGWQG-CRHGTC-----TIPWQCACDEGWGGLFCD.... 257
22 -10.7004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  23  149...VVCSDNYYGDSCSRLCKKRDDHECQPDGSPSCLPGWTGYC-NGYC-----SKPDECNCRPGWQGPLCN.... 227
23 -10.7005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  21  24SYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYCQNGGTCRPTGDVTHECACLPGFTGQNCE.... 118
24 -10.5001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  34  49................................DQCEPN----CLNGGLC-KDDINSYECWCQVGFEGKNCE.... 83
25 -10.5002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  34  134..........................................CLNGGTCSNTGPDKYQCSCPEGYSGPNCE.... 162
26 -10.4001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  22  43................................DQCETS----CQNQGKC-KDGLGEYTCTCLEGFEGKNCE.... 77
27 -10.4005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  21  21SYICHCPPSFHGPTCRQDVNECGEKPGLCRHGGTCHNEVGSYCQNGGTCRPTGDVTHECACLPGFTGQNCE.... 115
28 -10.2001fax_L mol:protein length:96 FACTOR XA  ali model follow..  22  5................................DQCETS----CQNQGKC-KDGLGEYTCTCLEGFEGKNCE.... 39
29 -10.2004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  196TYAGEGPIGFKGNSVAGNNYAVENQWGGTS--APWHPGLYITSGDNGNT-FHGSMTYSGEGPIGFRAMALPQ... 279
30 -10.2001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  17  7................................DQCLVLPLEHPCASLCC-IDGIGSFSCDCRSGWEGRFCQR... 50
31 -10.1001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  25  48................................DQCEGH----CLNQGHC-KDGIGDYTCTCAEGFEGKNCE.... 82
32 -9.9001g1q_A mol:protein length:162 P-SELECTIN  ali model follow..  15  81......PNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQ-LETIGNYTCSCYPGFYGPECEY... 155
33 -9.8601dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  25  48................................DQCASS----CQNGGSC-KDQLQSYICFCLPAFEGRNCE.... 82
34 -9.5703s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  10  541....KIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPC-NGGCCLVKGDGTTRCSCPMHLVELSC..... 615
35 -9.5205f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  21  2................................NPC-------CQNRGVCMSVGFDQYKCDCTTGFYGENCSTPEF 42
36 -9.4101p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  22  48................................DQCETS----CQNQGKC-KDGLGEYTCTCLEGFEGKNCE.... 82
37 -9.3804d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  27  8..........................................CENGGCLPGLADGSFSCECPDGFTDPNCS.... 37
38 -9.2404xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  23  311..ECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMT-CFNGGRCSDSPDGGYSCRCPVGYSGFNCE.... 383
39 -9.1804fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  11  119TYNGEGPIGFKSEVTDGDTYSVENQWGGSA--APWHSNVDAKSNDGGKT-LSGTMTYNGEGPIGFRGTLTS.... 201
40 -9.0304xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  16  45...CISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDE-CLHNGRC-VDKINEFLCQCPKGFSGHLCQ.... 115
41 -9.0303s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  10  542....KIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPC-NGGCCLVKGDGTTRCSCPMHLVELSCG.... 617
42 -9.0104a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  10  544....KIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPC-NGGCCLVKGDGTTRCSCPMHLVELSCGGTK. 622

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;