current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5e6w_A mol:protein length:317 Integrin beta-2, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQLast
1 -103.0005e6w_A mol:protein length:317 Integrin beta-2  ali model  100  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQ 313
2 -75.2002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  100  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCE....................................... 274
3 -56.1005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  97  1EECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEHHH......................................................................................... 224
4 -54.3005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  99  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQ 552
5 -47.1004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  74  257................LTPNDGRCHLED--NLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQ 552
6 -41.6004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  27  286................VCPNDGLC-HLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQ--HQKKCSHMKVGDTASFSVTVNIPHCERRSHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSHHGNGSFQCGVCACHPGHMGPRCECGEDMLS----TDSCKEAPDHPSCSGRGDCYCGQCICHLS--PYGNIYGPYCQCDNFSCVRHKGLLCG--GNGDCDCGECVCRSGWTGEYCN 575
7 -40.6004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  28  266................VQPNDGQC-HVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPG--LKSCMGLKIGDTVSFSIEAKVRGCPQEKSFTIKPVGFKDSLIVQVTFDCDCACQAQPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDE-CSPREGQPVCSQRGECLCGQCVCHSSDFGK--ITGKYCECDDFSCVRYKGEMCS--GHGQCSCGDCLCDSDWTGYYCN 559
8 -35.9005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  78  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEPAAL----------QTLFQGPLGAQGKKKLALKKKNAQLK------WKLQALKKKLAQA................................. 504
9 -30.1004um9_B mol:protein length:483 INTEGRIN BETA-6  ali model follow..  19  4GGCALGGAETCEDCLLIGPQCAWCAQENFTHPSG-VGERCDTPANLLAKGCQLNFIENPVSLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEHLYENYAKLIPGATVGLLQKDSGNILQLIISAEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPH--------------CERRSRHIIIKPVGLGDALELLV--SPECNCDCQKEVEVNSSKC-HNGNGSFQCGVCACHPGHMGPRCE 474
10 -26.7003v4p_B mol:protein length:503 Integrin beta-7  ali model follow..  21  22MLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPEGATQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMCPTRLERCDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSTEISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATH-----CLPEPHLLRLRALGFSEELI--VELHTLCDCNCSDTQPQAPHCSD--GQGHLQCGVCSCAPGRLGRLCE 493
11 -25.7002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  19  51....................................................................................................VNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTV--NVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGLKTPQNAIFFKTPGGCRNGGFCN-RICECPDGFHGPHCEKALCTPRCMNGGLCCDKANCSTTCFNGGTCF-GKCICPPGLEGGKCIGKSKCKCS----KGYQGDLCSCGAHGTCHENKCQCQEGWHGRHCN 307
12 -21.1004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  21  148.......................................................................................................................................................................................VVCSCSRLCKKRDDHFGHYECQ-GSPSCLPGWTGKYCDQPICLSGC---------------HEQNGYCS-DECNCRPG------WQGPLCNECIPH---------KGCRHGTCTIPQCACDEGWGGLFCD 257
13 -20.3004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  24  147..............................................................................................................................................................................................................YRVVCSDNYYGDSCSRLCKKRDD---------------HFGHYECQ-GSPSCLPG------WTGKYCDQPICLSGC-------HEQNGYCSKDECNCRPGWQGPLCN 227
14 -19.3004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  21  197.............................................................................................................................................................................................ECNHLCTACMNNGVCHTGECICPPGFMGRTCECELHTFGRTCKERC----SGQEGCKSYVFCL-YGCSCATG------WKGLQCNCHPGFYGPDCKLRCSCNNGEMCD-QGCLCSPGWQGLQCE 319
15 -18.9003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  18  3........................................................................................................................................................................................ACELPECQED----AGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLCWKYFSDGHCDSQ----CNSAGCL--------FDGFDCQRAEGQCNPLYDQYCDHFSDGHCDQGCNSAECEWDGLDCA 117
16 -18.5003eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  18  1.........................................................................................................................................................................................................GEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYHCDSQCNSAGCFDGFDCQRAEGQCNPLYDQYCDHFSDGHCDQGCNSAECEWDGLDCA 118
17 -18.3004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  20  153.........................................................................................................................RVTCDDYYYGF-----GCNKFCRPRDDFFGHYAQNGNKTCMEGWMGP------------------ECNRAICRQGCSPKHGSCK-GDCRCQYGWQGLYCD-----------------KCIPHPGCVHGICNEPQCLCETN------WGGQLCDKDLNYCGTHQ----PCLNGGTCS--QCSCPEGYSGPNCE 303
18 -18.0001l3y_A mol:protein length:41 Integrin beta-2:CYSTEINE-RICH MODULE 3  ali model follow..  100  1.................................................................................................................................................................................................................................................................................ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQ 40
19 -17.5002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  22  1.........................................................................................................................................SARGGGGHDALKGPNVCSRYNAYCCPGWKTLPGGNQCIVPIC---------------RHSCGDGFCSRPNMCTCPSGQIAPSCG-------------SRSIQHCNIRCMNGGSCSDDHCLCQKG------YIGTHCGQPVCESGCLNGGRCVAP-------NRCACTYGFTGPQCE 136
20 -17.0003i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model follow..  18  1.........................................................................................................................................................................................................GEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCSDGHCDSQCNSAGCFDGFDCQRAEGQCNPLYDQYCDHFSDGHCDQGCNSAECEWDGLDCA 118
21 -16.8002ddu_A mol:protein length:387 reelin  ali model follow..  17  62............................................................................................................................................................GKSDGDRFAVTRDLTLKPGYVLQFKLNIGCTSQFSSTAP-SHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVDGVYISEPCPSYCSGHGDCISGVCFCDLG------YTAAQGTCVSNT----NHSEMFDRFEGKLSPLWYKITGGQVGTGCG 257
22 -16.7002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  13  77.....................................................................................................................................................................................................SLDKGIMA-TVNVPLLGTVPHKASVVQVGFPCLGKQDGAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCR-----------------NGGFCNERICECPDGFHGPHCE 179
23 -16.6001wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  17  2...........................................................................................................................RCGEQGSNMECPNNLC--------CSQYGYCGMGGDYCGKG-------------------CQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKLCPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCS--KWGSCGIGPGYCGAGCQSGGCD 170
24 -16.2003vi3_B mol:protein length:454 Integrin beta-1  ali model follow..  22  274................VLPNDGQCHLEN--NMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSFKIRPLGFTEEVEVILQYICECEGGLENLYFQ..................................................................................................................... 454
25 -16.1004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  24  8.....................................................................................................................................................................................................CENGGICLPGSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNP-CHNGGTCEISVCKCPRG------FNGIHCQHNINECEVEP-----CKNGGICTDLSCECPGEFMGRNCQ 132
26 -16.0001k7t_A mol:protein length:186 agglutinin isolectin 3  ali model follow..  18  5..................................................................................................................................................EQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLC----PNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCS--KWGSCGIGPGYCGAGCQSGGCD 170
27 -15.9002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  15  23.......................................................................................................................................................................................WRCNDSQCTAACKSCREAPGPFPGKLICEDIYWGADP-------------GPFCTPRPWGDCCDKAFCNKMTCRCMDE--------VKECADACKDC----------QRVESSEPPRYVCKDRFTGH... 125
28 -15.8005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  23  5........................................................................................................................................DPCASNPCANGGQCLPFEASYICHCPPSFHGP--------------TCRQDVNECGQKPGLCRHGGTCHNERCVCRATHTGPNCERPYVPCSPSP-------------CQNGGTCR--ECACLPG------FTGQNCEENIDDCPGNN-----CKNGGACVDGNCRCPPEWTGQYCT 156
29 -15.7002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  24  44..............................................................................................................................................................................................................GNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCE----TNWGGQLCDCLNGGTCSNTQCSCPEGYSGPNCE 162
30 -15.3005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  23  2........................................................................................................................................DPCASNPCANGGQCLPFEASYICHCPPSFHGP--------------TCRQDVNECGEKPGLCRHGGTCHNERCVCRATHTGPNCERPYVPCSPSP-------------CQNGGTCR--ECACLPG------FTGQNCEENIDDCPGNN-----CKNGGACVDGNCRCPPEWTGQYCT 153
31 -15.2004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  26  1..........................................................................................................................................................................................DVDECALGANPCEHAGKCLNTECQCLQGYTGPRCEIDVNECISNP-------------CQNDATCLDQQCICMPG------YEGVYCEINTDECASSP-----CLHNGRCVDKLCQCPKGFSGHLCQ 115
32 -14.9002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  4..........................................................................................................................................................................................DVDECSLGANPCEHAGKCI--ECQCLQGYTGPRCEIDVNECVSNP-------------CQNDATCLDQQCICMPG------YEGVHCEVNTDECASSP-----CLHNGRCLDKQCECPTGFTGHLCQ 118
33 -14.9004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  14  204PICLPGCDEQHGFCDKQGRYCDECIRYPGCLHGTCQQPQCNCQEGWGGLFCNQD-----LNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSA-------------MTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCV--LCRCQAGFSGRHCDDNVDDCASSP-------------CANGGTCRDGSCTCPPG------YTGRNCSAPVSRCEHAP-----CHNGATCHQRVCECARSYGGPNCQ 497
34 -14.5002wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  16  2...........................................................................................................................RCGEQGSNMECPNNLC--------CSQYGYCGMGGDYCGKG-------------------CQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCS--KWGSCGIGPGYCGAGCQSGGCD 170
35 -13.8004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  14  51.....................................................................................................................................................................................................SGDGGRTLTGVGEGPIGFRATLTQWHPGGTWVIGCRVNQQVVALDIESGDQGATLAGAGEGPIG------FKSQQADGGVYAVPWHNGGVWGSTDSGKTLNGAGEGPIGFKGNSVA 211
36 -13.8004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  16  40.....................................................................................................................................................................................................SDDGGKTLKGNGEGPIGFRGTLSSWQPGGVWVLGARDKQNIVAVSIKSNDGGKTLTGNGEGPIG------FKSEVTDGDTYSVPWHSGGVWKSNDGGKTLSGNGEGPIGFRGTLTS 201
37 -13.7002oo4_A mol:protein length:234 Neurogenic locus notch homolog protein 2  ali model follow..  14  9.....................................................................................................................................................................................................CARDGVCDEACNSHACQWDGGDCSLTMENPWAN--------------CSSPLPCDYINNQCDELCNTVECFDNFECQGNSKTCKYDK----DHFKDNHCNQGCNSEECGWDGLDCA 114
38 -13.5004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  15  4.....................................................................................................................................................................................................VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEAL---LFNNSRCDPA------CSSPACLYDNFDCHAGGRER-DHFADGRCDQGCNTEECGWDGLDC. 123
39 -12.9001ulk_A mol:protein length:126 lectin-C  ali model follow..  12  19.....................................................................................................................................................................................................CSQWGYCGTTEEYCGKGCQSQCDYNRCGKEFGGKESQYGWCGNSDGHCGEGCQSQCSYWRCGKDFGGRLCTEDMCC-----------------SQYGWCGLTDDHCEDGCQSQ... 121
40 -12.8001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  17  6................................................................................................................................................................................................................EEMKKGHLERECMEETCSYEEAREVFEDSDKTNESPCQNQGKCKDGTCTCLEG------FEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNG 121
41 -12.5001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  14  3...............................................................................................................................................................................................................QVICRDEKTQMIYQQHQSWLRP---------------VLRSNRVE--YCWCNSGRAQCHSVPVKSCSEPR------------CFNGGTCQQAVCQCPEGFAGKSCE 85
42 -12.4001ehd_A mol:protein length:89 AGGLUTININ ISOLECTIN VI  ali model follow..  14  4...................................................................................................................................................................................................GSQGGGATCPGLRCCSIWGWCGDSEPYCGRTC-----------------ENKCWSGERSDHRCGAAVGNPPCGQDRCC-----------------SVHGWCGGGNDYCSGGKCQYRCS 87
43 -11.8001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  18  6................................................................................................................................................................................................................EELRPGSLERECKEEQCSFEEAREIFKDAERTASSPCQNGGSCKDQICFCLPA------FEGRNCETHKDDQVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADG 124
44 -11.7004wnx_A mol:protein length:433 Netrin-4  ali model follow..  20  226................................................................................................................................................................................DFIVKGSCFCNGHADQCLPVEGFRPIK-VHGRCMCKHNTAGSHCQHCAPLYNDRPWEAADGRTGAPNECR---TCKCGVCNCQHN------TEGQHCQCKACSCHPVGSAILPFSSVTFCSNGDCPCKPGVAGPHCD 403
45 -11.6005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  22  3..............................................................................................................................................................................................................................................................AMSCIPGESSDNCTALVQTE-DNPRVAQVSITKCSSDMNGYCLHGYCRCEVGYTGVRCE 71
46 -11.6001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  12  6.........................................................................................................................................................................................LEEFVRGNLERECIEEKCSF--FENTEKTNEFWKQYVDGDQCEPNP-------------CLNGGLCKDDECWCQVG------FEGKNCELDATCNIKN-----GRCKQFCKTGALCSCTTGYRLAPDQ 121
47 -11.5001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  20  6................................................................................................................................................................................................................EEVKQGNLEREC----------LEEACSLEEAREVFED------------------EQTDEFWSKYKDGDQCEGHP-----CLNQGHCKDGTCTCAEGFEGKNCE 82
48 -11.3004ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  10  20....EVSGGDRLDCVKASDQCL--KEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKS--------------------------------------------------YNCRCKR----GMKKEKNCLRIYYQSLQGNDLLEDSPYEPVNSRLSDIFRAVPFISVEHISKGNNC-----LDAAKACNLDDTCK--ITPCTTSMSNEVCNCSCRDIACTERRRQTIVPVCSYEERERPNCLSLQDSCKTNYICRSRLADFFTNCSVSNCLKENYADC--DSSSLSVAPWCDCSSGNDLEDCL 321
49 -11.0001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  38  40...............................................................................................................................................................................................................................................................................................CLRKYKDFCIHGECICHPGYHGERCH 76
50 -11.0001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  16  9..................................................................................................................................................................................................ERECMEETCSY--FEDSDKTNEFWNKYKDGDQ---------CETSP----CQNQGKCKDGTCTCLEG------FEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNG 116
51 -11.0002iue_A mol:protein length:212 PACTOLUS I-DOMAIN  ali model follow..  128................QNTSDGRCHLDD--GMYRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVKTYEKLTTFIPKLTIGELSDDSSNVAQLIRNAYSK................................................................................................................................................................................................................... 211
52 -10.9003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  16  290................................................................................................................................................................................DIKVRGRCKCN-----LHATVCVYDN--SKLTCECEHNTTGPDCGCKPIPKGAANACIPSISSIGTNVCDNELHCQNGGCLCPAA------YTGILCE------------KLRCEEAGSCDSGQGAPPHG....... 419
53 -10.8004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  15  3.........................................................................................................................................................................................................................................EKCFEPQLLRFFHKNEIWY-AVARCQCKGPDAHCQRLASQACRTNPC----------LHGGRCLEVLCHCPVGYTGPFCD 80
54 -10.8001fyb_A mol:protein length:111 PROTEINASE INHIBITOR  ali model follow..  14  8.....................................................................................................................................................................................................CAGTKGC--KYFSDDGTFVCENCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCK-GTFVCEGESD----------PRNPKACP----RNCD----PRIAYGICPLA......... 111
55 -10.6001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  20  1...................................................................................................................................................................................................................SKHVDGDQCLVLPLEHPCASL------------CCGHGTCIDGSCDCRSG------WEGRFCQREVSFLNCSLDN---GGCTHYCLEERCSCAPGYKLGDDL 89
56 -10.4004aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  17  277......................................................................................................................VHGHCMCRHNTKGLNCE--LCMDFYHDRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCELCEPCTCGQCRCKLHVEGERCDVCKEGDLSAEDPYGCKSCACNPLGTIPGGNPCGYCYCKRL------VTGQRCDCRPCDCDLGGALNNSCSEDS----GQCSCLPHMIGRQCN 524
57 -10.2004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  15  404...................................................AFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGSPTGRCEWRQG----------------------DGKGITRNFSTCSPS-TCPDGHCDVVETQDINICDCLRGSIVGGHEPG-----EPRGIKAGYGTCNCEKCFCEPED-----IQDPLCD----LCR................................ 607
58 -10.1003ltf_D mol:protein length:58 Protein spitz  ali model follow..  19  2...........................................................................................................................................................................................................................................................................FPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCE 47
59 -10.1003g5c_A mol:protein length:510 ADAM 22  ali model follow..  19  225.........................................................................................................................ECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVEAVNDCDIRETCSGNSSQCAPNIHKMDGYSCGVQGICFGGRCQCKYIWTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNLGYVEDGTPC-CLEHRCLPVASFNFSCSGNGVCSNLKCVCNRHWIGSDCN 480
60 -9.9604zxb_E mol:protein length:894 Insulin receptor  ali model follow..  13  6EVCPGMDIRNNLTRLHELENCS---------EGHLQILLMFKTRPEDFRDLSFPKLIMITDYL-----------LLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATID---SRILDSVEDNHIVLNKDDNEECGDICPGTAKGKTNCP---------ATVINGQFVERCSHCQKVCPTICKSHGCTAEGLCCSECLGNCSQPDDPTKCV---ACR-GRCVCPPPYQDWRCVNFSFCQDLHHKCKNSRRQGCH---QYVIHNNKCICPSGYSNLLCT 302
61 -9.5903cfw_A mol:protein length:164 L-selectin  ali model follow..  20  83.....................................................................................................................................................................................................................................................NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECV--TCNCDVGYYGPQCQ 154
62 -9.5404ove_A mol:protein length:437 Netrin-1  ali model follow..  20  255...............................................................................................................................................................................SDLQVGGRCKCNG-----HAARCVRDRD-DSLVCDCRHNTAGPECDCKPFHYDRPWQRATAREANECVACNCNLRCRFGVCLCRHN------TAGRHCHCKACDCHPVGAAGKTCNQTT----GQCPCKDGVTGITCN 413
63 -9.4504urt_A mol:protein length:420 NETRIN-1  ali model follow..  24  245.........................................................................................................................................................................................................GRCKCLVCDCRHNTAGPECDCKPFHYDRPWQRATAREANECVACNCNLRCRFGVCLCRHN------TAGRHCHTHRKAC-----KACDCHPVGACTTGQCPCKDGVTGITCN 397
64 -9.3401tx6_I mol:protein length:125 Bowman-Birk type trypsin inhibitor  ali model follow..  19  10.............................................................................................................................................................................................................CDEAVC-TRSIPPICTCMDEVFECPKTCKSCGPSMGDPSR----------RICQDQYVGDPGPICRPWECDKAICTRSNPPTCRCVDEVTCLPSRRVCIDSYFGPRCT 123
65 -9.2604mzv_A mol:protein length:248 Epithelial cell adhesion molecule  ali model follow..  11  1....................................................................................................................................................................................EEECVCENYKLA----NCFVNN---NRQCQCTSVGAQNTVICSKLAAKCLVMKAEMQGSKLGPDCDESGLFKAKQCQ---------------------------------------GTSTCWCVNTAGVRRTD 105
66 -9.2502bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  19  9.....................................................................................................................................................................................................CPQDSSCVNAACRCNPGFSSFSEIITTPMETCDDINEC--ATLSKVSCGKFSDCW--DCVCSPGYEPVS--SENTCECSSGQHQCDSSTVCFNTVGS-----SCRCRPGWKPTVCE 143
67 -9.2004plm_A mol:protein length:432 Netrin-1  ali model follow..  22  259........................................................................................................................................................................................................GGRCKCLVCDCKHNTAGPECDCKPFHYDRPWQRATAREANECVACNCNLRCRFGVCLCRHN------TAGRHCHCKECDCHPVGAAGQTCNQTT----GQCPCKDGVTGITCN 412
68 -9.0401ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  17  1..........................................................................................................................................................................................NISQHQCVKKQCPQNSGCFRHECKCLLNYKQEGDKCENPNPTCNENNGGCDADAKCTEEDSGSNGKKITCECTKPD-SYPLFDGIFCS....................................... 93

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 1 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.