current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5e6v_A mol:protein length:224 Integrin beta-2, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst EECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEHHHLast
1 -78.8005e6v_A mol:protein length:224 Integrin beta-2  ali model  100  1EECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEHHH 224
2 -63.6002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  97  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQT 224
3 -56.1005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  97  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQT 224
4 -35.3005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  91  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEPAA 463
5 -35.1003v4p_B mol:protein length:503 Integrin beta-7  ali model follow..  30  22MLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPEGATQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPHPCPTRLERCQSALGFSEELIVELHTLCDCNCSDTQPAPHCSDGQGHLQCGVCSCAPGRLGRLCESRG 496
6 -35.1005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  91  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQT 463
7 -33.0004um9_B mol:protein length:483 INTEGRIN BETA-6  ali model follow..  25  4GGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGE-RCDTPANLLAKGCQLNFIENPVSQVEILKNKPSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSCHNGNGSFQCGVCACHPGHMGPRCESRG 477
8 -32.4003vi3_B mol:protein length:454 Integrin beta-1  ali model follow..  23  5NRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNEDIHQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTTPFLSLTNKGEVFNELVGKQRISGNAIMQVAVCGSLIGWRNVT..... 251
9 -31.1004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  91  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQT 463
10 -25.6004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  26  21GGCALGGAETCEDCLLIGPQCAWCAQENFTHPSG-VGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSHHGNGSFQCGVCACHPGHMGPRCECGE 494
11 -24.0004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  31  3NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSP----RCDLKENLLKDNCAPESIEFPVSEARVLEDRPSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSCNNGNGTFECGVCRCGPGWLGSQCECSE 475
12 -16.1002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  31  147.............................................................................................................................................................................................QQAECPGGCRNGGFCNERICECPDGFHGPHCEGTK 182
13 -14.9002iue_A mol:protein length:212 PACTOLUS I-DOMAIN  ali model follow..  91......QVAICLGVLVTDNDFHLAKDKTLGTRQNTSDGRCHLDDGQLASKLAENNIQPIFVVPSRMVKTYEKLTTFIPKLTIGELSDDSSNVAQLIRNAYSKL......................................................................................................................... 212
14 -14.7004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  20  181......................................................................................................................................................................................SPSCYCDQPICLSGCHEQNGYCS-DECNCRPGWQGPLCN... 227
15 -13.8002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  13  158GAARAWMAGTLQLGRALRPRGLWC---NYDFLSPNYTGQCPSGIRAQNDQLGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSW------------ENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCS---------QALCSGHGRCV--KCRCYPGWQAPWCE... 411
16 -12.9002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  11  116VAAFEVDVIVMNSKT-FFKTCQ-CPGGCRNGGFCNERRICECPDGFHGPHCEKAL--------------------CTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYGKCICPPGLEGEQCEISKCPQPCRNGGKCIG-----------------------------KSKCKCLCSKPVCEPG-CGAHGTCH-NKCQCQEGWHGRHCN... 307
17 -12.5004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  20  180......................................................................................................................................................................................SPSCYCDQPICLSGCHEQNGYCS-DECNCRPGWQGPLCN... 226
18 -12.5004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  12  429.................................................SAEDTSGILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGRCEWRQGDG---------GITRNFSTCSPSTKTC--PDGHCDVVETQDINICPQDCLRGSIPRGIKAGYGTCNCEKCFCEPEIQDPLCDCR. 607
19 -12.2002ddu_A mol:protein length:387 reelin  ali model follow..  28  187..........................................................................................................................................................................................GVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQGT... 221
20 -12.1003cfw_A mol:protein length:164 L-selectin  ali model follow..  32  108........................................................................................................................................................................................ACHCYTASCQPWSCSGHGECV--TCNCDVGYYGPQCQDPR 161
21 -12.0004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  18  177..FTSAFTRLIVRC-KWGPECN-CTACMNNGVCHEDTGECICPPGFMGRTCEKA----------------------------------------------------------------------CELHTFGRTCKE----------------RCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDSCNNGEMCD-QGCLCSPGWQGLQCE... 319
22 -11.8003okt_A mol:protein length:681 Plexin-A2  ali model follow..  11  478ESCEQY--TTCGECLSSGPHCGWCA----------LHNMCSRRDKCQRAWEANRFAASISQCMSLEVHPNSISVSDHSRLLSLVVNDAPNLSEGIACAFGNLTEVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCS-------------------AHQLCLCVNSAFRCH---CKYRNLCTHDPTTCSFQRINVSEDCPQ 672
23 -11.6003ol2_B mol:protein length:528 Plexin-B1  ali model follow..  18  464ASCAQH--LDCASCLAHDPYCGWCV----------LLGRCSRRSECSRGQGPEQWLWSFQPELG................................................................................................................................................................ 516
24 -11.5004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  11  204PICLPGCDEQHGFCDKQGRYCDECIRYPGCLHGTCQQPQCNCQEGWGGLFCNQD-----LNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSA-------------MTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCV--LCRCQAGFSGRHCDDN. 423
25 -11.3004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  18  185........................................................................................................................GNKTCMEGWMGPECNRAICRQGCSPKHGSCK---LPGDCRCQYGWQGLYCDKCIPHPGCVHGICQCLCENYCGTHQPCLNGGTCS--QCSCPEGYSGPNCEIVD 306
26 -11.2003nvn_B mol:protein length:476 Plexin-C1  ali model follow..  22  419ANCNKH--KSCSECLTADPHCGWCH----------SLQRCTFQGDCVHSENLENWLDISSGAKK................................................................................................................................................................ 471
27 -10.8003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  21  180........................................................................................................................................................................................GCEGPSTTCQEDSCSNQGVCL--SCDCSTSFSGPLCN... 221
28 -10.6001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  30  37........................................................................................................................................................................................NKYKDGDQCETSPCQNQGKCKDGTCTCLEGFEGKNCELF. 79
29 -10.3001l3y_A mol:protein length:41 Integrin beta-2:CYSTEINE-RICH MODULE 3  ali model follow..  31  6..........................................................................................................................................................................................NCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQ... 40
30 -10.3001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  28  42........................................................................................................................................................................................SKYKDGDQCEGHPCLNQGHCKDGTCTCAEGFEGKNCEFS. 84
31 -10.2001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  25  43........................................................................................................................................................................................KQYVDGDQCEPNPCLNGGLCKDDECWCQVGFEGKNCELD. 85
32 -9.9604bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  27  29.......................................................................................................................................................................................ARCQCASQACRTNPCLHGGRCL--LCHCPVGYTGPFCDVD. 82
33 -9.9001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  18  3........................................................................................................................................................................................SHLVKCAEKEKTFCVNGGECF--LCKCQPGFTGARCT... 48
34 -9.8301tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  29  33......................................................................................................................................................................................YCWCSVPVKSCSEPRCFNGGTCQ--VCQCPEGFAGKSCEID. 87
35 -9.7303g5c_A mol:protein length:510 ADAM 22  ali model follow..  13  232AECVLEGAECCKKCLTQDSQCS-CKKCKFQPMGTEAVNDCDIRETCSGNSCDGVQGICFGGRCKTRDRQCKYI-----GQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCNFSTCLSSKEGTICSGNGVCS-LKCVCNRHWIGSDCN... 480
36 -9.6701gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  16  1......................................................................................................................................................................................APTCANNRHQ-----CSVHAECR--CCRCVANYTGNGRQCVA 45
37 -9.5703al8_B mol:protein length:539 Plexin-A2  ali model follow..  35  479ESCEQY--TTCGECLSSDPHCGWCA----------LHNMCSRRDK................................................................................................................................................................................... 512
38 -9.4501xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  24  39........................................................................................................................................................................................PCL----RKYKDFC--HGECK--SCICHPGYHGERCH... 76
39 -9.4001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  24  1........................................................................................................................................................................................NSYPGCPSSYDGYCLNGGVCM--TCNCVIGYSGDRCQ... 43
40 -9.2804wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  25  2.........................................................................................................................................................................................DIVDGDQCESNPCLNGGSCKDDECWCPFGFEGKNCELLE 44
41 -9.2001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  28  43.........................................................................................................................................................................................SYSDGDQCASSPCQNGGSCKDQICFCLPAFEGRNCETH. 84
42 -9.1904d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  20  92........................................................................................................................................................................................HCQHNINECEVEPCKNGGICTDLSCECPGEFMGRNCQYK. 134

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.