current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 5e6r_B mol:protein length:510 Integrin beta-2, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# Score Template Links and tools%idFirst QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEPAALQTLFQGPLGAQGKKKLQALKKKNAQLKWKLQALKKKLAQALast
1 -164.0005e6r_B mol:protein length:510 Integrin beta-2  ali model  100  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEPAALQTLFQGPLGAQGKKKLQALKKKNAQLKWKLQALKKKLAQA 504
2 -135.0005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  91  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQCRKDNNSIICSGLGDC-VCGQCLCHTSIYGQYCECDTINC 519
3 -132.0003v4p_B mol:protein length:503 Integrin beta-7  ali model follow..  52  22MLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQTQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLRLRALGFSEELIVELHTLCDCNCSDTQQAPHCSDGQGHLQCGVCSCAPGRLGRLCESRGLENLY.................................... 501
4 -129.0004um9_B mol:protein length:483 INTEGRIN BETA-6  ali model follow..  38  4GGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGE-RCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELETAICNNGTLFQHQKKCSHMKVGDTAS---FSVTVNIPHCERRSRHIIIKPVGLGDALELLVS--------PECNCDCQKEVEVNSSKCHNGNGSFQCGVCACHPGHMGPRCESRGLQTLFQ................................... 483
5 -126.0004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  91  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQCRKDNNSIICSGLGDC-VCGQCLCHTSIYGQYCECDTINC 519
6 -118.0004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  36  21GGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGE-RCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLHHGNGSFQCGVCACHPGHMGPRCECGECKEAPDHPSCSGRGDCYCGQCICHLS----------PYGNIYGPYCQCDNSCVRHKGLLCGGNGDCDCGECVCRSGWTGEYCNCSTDSCVSEDGVLCSGRGDC-VCGKCVCNPGASGPTCECPTCGD 622
7 -116.0003vi3_B mol:protein length:454 Integrin beta-1  ali model follow..  50  5NRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNHQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS-EQNCTTPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSFKIRPLGFTEEVEVILQYICECEGGLENLYFQ..................................................................... 454
8 -113.0004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  35  3NICTTRGVSSCQQCLAVSPMCAWCSDEALP----LGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDAHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRNNGNGTFECGVCRCGPGWLGSQCECSECSPREGQPVCSQRGECLCGQCVCHSSDFGK----------ITGKYCECDDSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCRTDTCMSSNGLLCSGRGKC-ECGSCVCQPGSYGDTCECPTCPD 606
9 -77.5002iue_A mol:protein length:212 PACTOLUS I-DOMAIN  ali model follow..  62  1.....................................................................................................DNSVDLYFLMGLSGSAQGHLSNVQTLGSDLLKALNEISRSGRIGFGSIVN----------------------------MTFQHILKLTADSSQFQRELRKQLVSGKLATPKGQLDAVVQVAICLGEIGWRNGTRFLVLVTDNDFHLAKDKTLGTRQNTSDGRCHLDDGMYRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVKTYEKLTTFIPKLTIGELSDDSSNVAQLIRNAYSKL................................................................................................................................................................... 212
10 -39.9002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  53  17................................................................................................................................................................................................................................................................SGPGCTWCQKLNGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNV-TFRRAKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQCRKDNNSIICSGLGDC-VCGQCLCHTSIYGQYCE...... 274
11 -35.9005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  78  1QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKLS-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQCRKDNNSIICSGLGDC-VCGQCLCHTSIYGQYCECDTINC 280
12 -35.3005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  91  1EECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYSRVFLDHNALPDTLK-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEHHH......................................... 224
13 -15.4002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  12  2...................................................................................................................................................................................................................TGSLYLWIDAHQARVLIGFEE--DILIVSEGKMAPFTHDFRKAQQRMPHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFENTILKTPQNAIFFKTCQQAECPGGCRNGGFCN-RICECPDGFHGPHCEKALCTP-----RCMNGGLCTPGFCICPPGFYGVNCDKANCSTTCFNGKCICEQCEISKCPQPCRNGGKCI-SKCKCSKGYQGDLCS------KPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEAS 313
14 -14.8004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  11  35........................................................................................................................................................................................................................................................................................................................RICLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIILAVGKNWKSDEQNNTLTRLRYSYRVVCSCSRLCKKRDDHFGHYECQ-GSPSCLPGWTGKYCDCLSGC--------HEQNGYCSKPDECNCRPGWQGPLCN...... 227
15 -13.8002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  12  2.....................................................................................................................................................................................................................................................................................................................................................ARGGGGHDALKGPNVCGSYNAYCCPGWKTLPGG-NQCIVPICRHSCGDGFCSRPNMCTCPSGQIAP----------------SCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESG------CLNGGRCVAPNRCACTYGFTGPQCE...... 136
16 -13.4004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  153.......................................................................................................................................................................................................................................................................................................................RVTCDDYYYGFGCNKFCRPRDDFFGHYACDQN----------------GNKTCMEGWMGPECNRAICRQ----GCSPKHGSCKLPDCRCQYGWQ--------------GLYCD------KCIPHPGCVHGICNEPQCLCETNWGGQLCDKDLNYCGTHQP--CLNGGTCSNTGQCSCPEGYSGPNCE...... 303
17 -13.2004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  12  146.......................................................................................................................................................................................................................................................................................................................................................................YRVVCSDNYYGDSCSRLCKKR----DDHFGHYECQ-GSPSCLPGWTGK------------------YCDQPICLSGCHEQNGYCS-DECNCRPGWQGPLCN-------ECIPHKGCRHGTCTIPWQCACDEGWGGLFCDQAAA.. 261
18 -13.0004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  12  189..........................................................................................................................................................................................................................................................................................................................CEAQKWGPECNHLCT--------------------ACMNNGVCDTGECICPPGFMGRTCE-KACELHTFGRTCKER--------------------------------CSGQEG--------CKSYVFCL-YGCSCATGWKGLQCNCHPGFPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCE...... 319
19 -10.9002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  12.......................................................................................................................................................................................................................................................................................................................AVTCDDYYYGFGCNKFCRPRDDFFGHYACDQN----------------GNKTCMEGWMGPECNRAICRQ----GCSPKHGSCKLPDCRCQYGWQ--------------GLYCD------KCIPHPGCVHGICNEPQCLCETNWGGQLCDKDLNYCGTHQP--CLNGGTCSNTGQCSCPEGYSGPNCE...... 162
20 -10.8003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  13  67.....PPDITCGD-----PPETFCA----MGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYP-KPLQVNITL----------------------------------------SWSKTI-----ELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSK----------------------IIHFEIKDRFAFFAGPRLRNM--------SLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYA----ISDIKVRGRCKCNLHATVCVYDNSK--------------------LTCECEHNTTGPDCG------------------------KCKKNYQGRPWSPGSYLPIPKGAANACIPSISSIGTNVCDNELHCQNGRCLCPAAYTGILCELR-----------CEEAGSCSDSGQGAPPHG............. 419
21 -10.5001wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  10  18..............................................................................................................................................................................................................................................................................................................................................................CSQYGYCGMGGDYCGKG-----CQNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG 171
22 -10.2005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  12  26........................................................................................................................................................................................................................................................................................................................................................................ICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNERCVCRATHTGP----------------NCERPYVPCSPSPCQNGGTCR--ECACLPGFTGQNCEENIDDCPGN---NCKNGGACVD--NCRCPPEWTGQYCT...... 156
23 -10.2005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  11  23........................................................................................................................................................................................................................................................................................................................................................................ICHCPPSFHGPTCRQDVNECGEKPGLCRHGGTCHNERCVCRATHTGP----------------NCERPYVPCSPSPCQNGGTCR--ECACLPGFTGQNCEENIDDCPGN---NCKNGGACVD--NCRCPPEWTGQYCT...... 153
24 -9.9502wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  11  18..............................................................................................................................................................................................................................................................................................................................................................CSQYGYCGMGGDYCGKG-----CQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSPNNLCCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDA 171
25 -9.6304aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  12  10.......SYGCAECLSVTSTCGLHKPEPY----------CIVSHLQEDKKCFICDSRDPY-------HETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQL----DLEAEFH--------------------FTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGIS----TGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLG---NLLDSRMEIREKYYYAVYDMVVRGNCFCYG---HASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCECMDFYHDLPWRPAEGRNSNACKKCNCNEHSSVSGGVCDCQHNTMGRNCEQCK-PFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLQCRCKLHVEGERCDVCYGCKSCACGYCYCKRLVTGQRCD----QCLPQHWGLSNDLDGCRPCGQCSCLPHMIGRQCN...... 524

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;