current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4xlw_B mol:protein length:261 Delta-like protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst SSSIFQLRLQEFANERGMLANGRPCEPGCRTFFRICLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNECIPHKGCRHGTCTIPWQCACDEGWGGLFCDQAAALast
1 -85.1004xlw_B mol:protein length:261 Delta-like protein  ali model  100  1SSSIFQLRLQEFANERGMLANGRPCEPGCRTFFRICLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNECIPHKGCRHGTCTIPWQCACDEGWGGLFCDQAAA 261
2 -60.5004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  99  2SSSIFQLRLQEFANERGMLANGRPCEPGCRTFFRICLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNEAA................................ 230
3 -53.2004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  36  1.SGQFELEILSMQNVNGELQNGNCCGGACDTYFKVCLKEYQSRTAGGPCSFGSGSTPVIGGNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKAS---------HSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLN 267
4 -45.4002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  44  3.........................................................................................................................................GSGSIEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLN 126
5 -43.6004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  42  1SSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVVSPEPPCTYGSAVTPVLGVSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLN 270
6 -41.2002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  18  99.........................KASVVQVGFPCLGKQDGVAAFEVDV-IVMNSEGNTILKTPQNAIFFKTCQQAEC----------------------PGGCRNGGFCNERRICECPDGFHGPHCEKALCTPCMNGGLCVTPGFCICPPGFYGVNCDKANCSTT-CFNGGTCFYPGKCICPPGLEGEQCEISKCPQP-CRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCAHGTCHEPNKCQCQEGWHGRHCNKRY. 310
7 -33.9005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  22  6..............................................................................................................................PCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVQKPGLCRHGGTCHNSYRCVCRATHTGPNCERPYCSPSPCQNGGTCRPTHECACLPGFTGQNCDDCPGNNCKNGGACVNTYNCRCPPEWTGQYCTE... 157
8 -33.7005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  22  3..............................................................................................................................PCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVEKPGLCRHGGTCHNSYRCVCRATHTGPNCERPYCSPSPCQNGGTCRPTHECACLPGFTGQNCDDCPGNNCKNGGACVNTYNCRCPPEWTGQYCTE... 154
9 -31.8004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  39........................................................................................................................RSGQNVVALNIKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNTGSSAPWHPGGTWTMTYAGEGPIGFKSQQADGGVGSSAPWHNGGVWVMTYAGEGPIGFKGNSVAVELYITSGDNGNTFHGYSGEGPIGFRAMALPQ... 279
10 -30.6002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  20  13.........................................................................................................................................GPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSDGFCSRPNMCTCPSGQIAPSCGSRSHCNIRCMNGGSCS-DDHCLCQKGYIGTHCGQPVCEGCLNGGRCVAPNRCACTYGFTGPQCE.... 136
11 -29.8004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  24  3...................................................................................................................................................................CDPNPCENGGICLPSFSCECPDGFTDPNCSSVVCTPNPCHNGGTCEIGYVCKCPRGFNGIHCQECEVEPCKNGGICTANYSCECPGEFMGRNCQYKGG 136
12 -29.6004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  1...................MAAYLVQNQWGGSQATWNPGGLWALDIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSAPWQPGGV-------------------VLGARDKQNIVAVSIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDTGSAAPWHSGGVWTMTYNGEGPIGFRGTLTSPDTVENQWGGSTAPWNPGGFWM--IGARNGQNVVALNVASSDGGKTLAGYNGEGPIGFRAR....... 265
13 -28.7004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  24  1.............................................................................................................................................................DVDECALGANPCEHAGKCLNSFECQCLQGYTGPRCEIDVCISNPCQNDATCLDEFQCICMPGYEGVYCDECASSPCLHNGRCVNEFLCQCPKGFSGHLCQSGR. 118
14 -28.4002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  25  3............................................................................................................................................................QDVDECSLGANPCEHAGKCINSFECQCLQGYTGPRCEIDVCVSNPCQNDATCLDEFQCICMPGYEGVHCDECASSPCLHNGRCLNEFQCECPTGFTGHLCQVDL. 121
15 -28.0004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  28  189.....................................................................................................................................................CEAQKWGPECNHLC---TACMNNGVCHETGECICPPGFMGRTCEKATCKERCCKSYVFCLDPYGCSCATGWKGLQCNEACHPSCNNGEMCDRFQGCLCSPGWQGLQCEREGI 323
16 -26.9001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  14  1..............................................................................................................................................ANAFLEELRPGSLERECKEEQCSFEEAREIF-------KDAERTKLFWISDGDQCASSPCQNGGSCKDSYICFCLPAFEGRNCEDQLICVNENGGCEQTKRSCRCHEGYSLLADGVSCT 128
17 -26.9001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  17  1..............................................................................................................................................ANSFLEEMKKGHLERECMEETCSYEEAREVFEDSDK-----TNEFWNKYKDGDQCETSPCQNQGKCKDEYTCTCLEGFEGKNCELCSLDNGDCDQFCHNSVVCSCARGYTLADNGKAC. 124
18 -26.0001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  15  1.........................................................................................................................................................YNSGKLEEFVNLERECIEEKCSFEEARENTEKTNEFWKQDGDQCEPNPCLNGGLCKDSYECWCQVGFEGKNCELNIKNGRCKQFCKTSKVLCSCTTGYRLAPDQKSCK 125
19 -24.7001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  19  1.................................................................................................................................................................................SYQVICRDEKTQMIYQQHQSWLRPVLRSNRV---EYCWCNSGRAQVPVKSCSEPRCFNGGTCQSDFVCQCPEGFAGKSCEIDTR 89
20 -24.3002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  15  77.......................................................................................................................................SLDKGIMADPTVNVPLLGTVPHKASVVQV---------------GFPCLGKQDGVAAFEVDVIVM-NSEGNTILKTPQNAIFFKT----CQQAECPGGCNGGFCNERRICECPDGFHGPHCEGT.. 181
21 -23.7001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  45...............................................................................................................................CETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFLCSLDNGDCDQFCHESVVCSCARGYTLADNGKACTGPYPCGKQTLERRKAQATSSSGEAPDSIDAADLDPTENPFDLLDTQPERGDNNLTRIVGGQE.. 195
22 -22.2001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  21  1.......................................................................................................................................................................................SKHVDGDQCLLEHPCASLCCGHGTCIDSFSCDCRSGWEGRFCQNCSLDNGGCTHYCLGWRRCSCAPGYKLGDDLLQCH 93
23 -21.1005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  21  184...................................................................................................................................................CEC-------RCRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCECQTQGRSSCSGLGDCV--GQCLCHTSIYGQYCECDTINGGPGRGLCFCG-KCRCHPGFEGSACQ.... 313
24 -20.8001fax_L mol:protein length:96 FACTOR XA  ali model follow..  23  3................................................................................................................................................................................................DGDQCETSPCQNQGKCKDEYTCTCLEGFEGKNCELCSLDNGDCDQFCHASVVCSCARGYTLADNGKACI 82
25 -20.7002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  25  184...................................................................................................................................................CEC-------RCRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCE--------CQTQGRSSQELEGSCRKDNNSIICS--------GLGDCVCG-QCLCHTSIYGQYCE.... 274
26 -20.3001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  13  1...............................................................................................................................................................................ANSFLEEVKQGNLERECL----------EEACSLEEVFEDAEQTDEFWSKDQCEGHPCLNQGHCKGDYTCTCAEGFEGKNCEFSTR 86
27 -19.5004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  21  1............................................................................................................................................................................................GSEKCFEPQLLRFFHKNEIWYRAAVARCQCKGPDAHCQACRTNPCLHGGRCLGHRLCHCPVGYTGPFCDVDTA 84
28 -19.5001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  16  6..............................................................................................................................AVTVDTICKNGQLVQMSNHFKCMCNEGLVENTCEEK-TLGKACGEFGQCIEMYKCGCIEGYKEDTCVLDVCQYKNCGESGECIQSAGCSCAIGKVEKKCTKCQLKCNTDNEVCKNVYKCQCMEGFTKNVC..... 177
29 -19.1002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  16  22..................................................................................................................................................QWRCNDELEPSQCTAAC---KSCREAPGP-FPGKLICEDIYWGADPGPFCTPRGDCCDKAFCNKMNPPTCRCMDEVKECADACKD--CQRVESSEPPRYVCKDRFTGPVCKPR.. 133
30 -18.4003i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model follow..  18  10.....................................................................................................................................................CQEDAGNKVCSLQCNNHACGWDGGDCSLTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRA-EGQCNPLYDQ------YCKDHFSDGHCDQG--NSAECEWDGLDCAEHVP 122
31 -18.3003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  17  1...........................................................................................................................................................GSACELPECQEDA--GNKVCSLQ--NNHACGWDGGDCSLNFNDPWKNCTQS-------LQCWKYFSDGHCDSQCNSAGCSDGHCDQG-CNSAECEWDGLDCAEHVP 121
32 -17.0002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  21  2...........................................................................................................................ADIDECESSPCINGVCKNSPGSFICECSSESTLDP------------TKTICIETIKGTCWQTVIDGRCEINILKSQCCSSLGAAWGQVDPICGKGYSGTQCDECEVFPGCKNGLCVNSFKCQCPSGMTGRIC..... 146
33 -16.6005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  26  447..................................................................................................................................................ICRCDTGYIGKNCERKDNNSIICSGLGDCV--GQCLCHTSIYGQYCE---CDTINCEGRGLC-FCGKCRCHPGFEGSACQCERTTEGCGRGRCRCN-VCECHSGYQLPLCQE... 592
34 -16.1001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  17  5..............................................................................................................................ECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLGDNGDTACSNEIGVASCCCSLGKAWGTPCEMCPAVNTKILCPGGEGFRTVILDECQELPGCQGGKCINSFQCRCPTGYYTRVCD.... 162
35 -15.9002ddu_A mol:protein length:387 reelin  ali model follow..  11  106........................................................................................................SHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDF-----EEWTRITIAIPRSLASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCIS-GVCFCDLGYTAAQGTCVSNTPNHFEGKLSPLW-YKITGGQVGTGCGTLND 261
36 -15.7003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  18  302......................................................................................................................................HATVCVYDNSKLTCECEHNTTGPDCGK---------------------CKKNYQGRACIPSISSIGTCQNGGTCHNNVRCLCPAAYTGILCEKLRCEE---AGSCSDSGQGAPPHG........... 419
37 -15.6004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  27  479...................................................................................................................................................CACHPGHMGPRCEKEAPDHPSCSGRGDCY--GQCICHLSIYGPYCQCDSCVRHLCGGNGDCD--GECVCRSGWTGEYCNCTTSTDSCDGVLCSGRGDCVCNPGASGPTCER... 616
38 -15.4004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  18  332.........................................................................................................................................VTSHTRPDHETKCPPREKGKYCKPMNRASLSNATAEQCGQLSSADGSSLSSQVRGYHATFVATDCNMGESCAATARGKCFFYSTVPECDKCVSVDCGAHGTCDATGKCVCEPGFTGERCDAAAL 505
39 -15.3003eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  18  10.....................................................................................................................................................CQEDAGNKVCSLQCNNHACGWDGGDCSLTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRA-EGQCNPLYDQ------YCKDHFSDGHCDQG--NSAECEWDGLDCAEHVP 122
40 -15.2002oo4_A mol:protein length:234 Neurogenic locus notch homolog protein 2  ali model follow..  15  1...........................................................................................................................................................GATCLSQYCADKA--RDGVCDEA--NSHACQWDGGDCSLTMENPANCSSPLPCWDYINNQCDELFDNFECQDKYCADHFKDNHCNQG--NSEECGWDGLDCAADQP 118
41 -14.8004wnx_A mol:protein length:433 Netrin-4  ali model follow..  17  232...................................................................................................................SCFCNGHADQCLPVEGFRPIKAPGAFHVVHGRCMCKHNTAGSHCQHCAAADGRTGAPNECRT---CKCNGHADTCHFDVNVWEASGNRSGGVCNN-----CQHNTEGQHCQRCKPPDACKACSCPSNGDCPCKPGVAGPHCDR... 404
42 -14.7004ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  13  25.......DRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSAKDECRSAEALKQKSLYNCRCKGMKKEKNCLRIYWSMYQSLQGND--LLEDSPYEPVNSRLSDIFRAVPFISVEHISKGNNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRKCHKAEERERPNCLS-LQDSCK---TNYICRFTNCQPESRSVSN-CLKENYADCLLAYSGLIGTVMTPNYVDSSSLSVAPW-CDCSSGNDLEDCLK... 322
43 -14.7002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  23  3............................................................................................................................................................RGCARWCPQ------DSSCVNATACRCNPGFSSETCDINECAKVSCGKFSDCWNSYDCVCSPGYEENTCDECSSGQCDSSTVCFNSYSCRCRPGWKPR....... 130
44 -14.6004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  24  460...................................................................................................................................................CRCGPGWLGSQCECSEEDYRPCSQRGECL--GQCVCHSSDFGKECDDFSCVRY-CSGHGQCS--GDCLCDSDWTGYYCNCTTRTDTCNGLLCSGRGKCECQPGSYGDTCEKCPT 603
45 -14.0004aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  15  254...................................CFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGV---------CDNCQHNTMGRNCQCKPFYFQNLCEPCTCDPAGSENGGICDGAGQCRCKLHVEGERCDVCKCKSCACNPLGTCDSTGYCYCKRLVTGQRCDQCLPQDGCRPCDCEDSGQCSCLPHMIGRQCNE... 525
46 -13.8004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  26  447..................................................................................................................................................ICRCDTGYIGKNCECQTQGRSSCSGLGDCV--GQCLCHTSIYGQYCE---CDTINCEGRGLC-FCGKCRCHPGFEGSACQCERTTEGCGRGRCRCN-VCECHSGYQLPLCQECPG 595
47 -13.7003cfw_A mol:protein length:164 L-selectin  ali model follow..  23  86..........................................................................................................................................................NKEDCVEIYIKRNKDAGKW---NDDACHKLKAA----CYTASCQPWSCSGHGECVENYTCNCDVGYYGPQCQFVQV............................... 158
48 -13.7004urt_A mol:protein length:420 NETRIN-1  ali model follow..  23  263................................................................................................................................................SLVCDCRHNTAGPECDRCKPQRATAREANECVA---CNCNLHARRCRFNMELYKLSGRKSGGVC-----LNCRHNTAGRHCHYCKERKACKACDCQTTGQCPCKDGVTGITCNR... 398
49 -13.5004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  17  9..................................................................................................................................................RCPCQAKRGDQRCDRECNSPGCGWDGGDCSGDPWRQCEALQCWRLFNNSRCDPAC--SSPACLDNFDCHAGGRERTCNPYEKYCADHFADGRCDQG--NTEECGWDGLDCASEVP 128
50 -13.3005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  12  360.................................................................................................................................................YDSFCSNGVTHRNQPRGDCDGVPITFQVKVT--TECIQEQSFVIRRCRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCEFQGPLGAQGKKKLQALKKKNAQLKWKLQALKKKLA 502
51 -12.9003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  16  147......................................................................................................................................................KEGFQG-------CLASVDLNGRLPDLISDALFCNGQIERGCESTTCQEDSCSNQGVCLDGFSCDCSTSFSGPLCNDPGTTYIFSKGGGQITYK................. 239
52 -12.9004ove_A mol:protein length:437 Netrin-1  ali model follow..  22  279................................................................................................................................................SLVCDCRHNTAGPECDRCKPQRATAREANECVA---CNCNLHARRCRFNMELYKLSGRKSGGVCLN-----CRHNTAGRHCHYCKERKACKACDCQTTGQCPCKDGVTGITCNR... 414
53 -12.6001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  18  1............................................................................................................................................................................................GTSHLVKCKEKTFCVNGGECFSRYLCKCQPGFTGARCTEKVQNQEKAEELYQK.................... 67
54 -12.5005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  20  183...................................................................................................................................................................................QCEC-------RCRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCE................................... 221
55 -12.5004plm_A mol:protein length:432 Netrin-1  ali model follow..  21  278................................................................................................................................................NLVCDCKHNTAGPECDRCKPQRATAREANECVA---CNCNLHARRCRFNMELYKLSGRKSGGVCLN-----CRHNTAGRHCHYCKERKACKECDCQTTGQCPCKDGVTGITCNR... 413
56 -12.5001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  21  4............................................................................................................................................................DGCL-----SNPCFPGAQCSSSWSCFCPVGFLGDECALVPDICFSTSKVPRCVNGFHCPCPPRYRGNQPVVCEPENPCKDKTCDPMYKCECQTGYAGDGLICGED 147
57 -12.5001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  21  3...........................................................................................................................................................................................EASNMSAHKCIDTNVPENAACYRTEEWRCLLGFKGGKCVPASITCEENNGGCAKEVECKCTKEGSGVFC..... 93
58 -12.4003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  16  6....................................................................................................................................................PCFRA----NCEYQCQPLNQ--------TSYLCVCAEGFAPIPHEPHRCQLTACPADCDPNTQASCECPEGYIGFICDECENGGFCSG-VCHNTFECICGPDSA......... 109
59 -12.4004mzv_A mol:protein length:248 Epithelial cell adhesion molecule  ali model follow..  13  3..................................................................................................................................................ECVCENYKLAVNCFV--------------NNNRQCQCTSVGAQNKCLVMKAEMQGSKLGRRAKPEGALQNNDGLYDPDCDE---SGLFKAKQCQGTSTCWCVNTAGVRRTDKDTE 109
60 -12.2001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  18  3................................................................................................................................................................................................SEHRCIDTNVPENAACYRTEEWRCLLYFKAGKCVPAPNGGCAPEAECKNEIVCKCTKEGSGVFCS.... 89
61 -12.2001k7t_A mol:protein length:186 agglutinin isolectin 3  ali model follow..  20  17...................................................................................................................................................CCSQYGYCGMGCGKGCQNGACCPNNHCCSQYGHCYCGAGCQGGPCRADIKCGSQCPNNLCCSQWGYCGLGSEFCGEGCQNGACRVCTNNYCCSKWGSCGIGPGYCGAGCQ.... 165
62 -12.2001npe_B mol:protein length:164 Laminin gamma-1 chain  ali model follow..  17  23...................................................................................................................................................THCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNR----LTGECLK-----CIYNTAGFYCDRCKEADKCKACACPVTGQCQCLPHVSGRDCGT... 148
63 -12.1003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  34  421..........................................................................................................................................................................RNGYCTPTGKCCCSPGWEGDFCRTAKCEP-ACRHGGVCVRPNKCLCKKGYLGPQCE................................... 475
64 -12.1001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  25  1..............................................................................................................................................................................................NISQHQCVKKQCPQNSGCFEREECKCLLNYKGDKCVNENNGGCDADAKCTKKITCECTKPDSGIFCS.... 93
65 -12.1002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  21  6.................................................................................................................................................................................DYDIPTTENLYFQGAGTNECLDNNGGCSHVCNDGYECLCPDGFQLVAQRRCEDDECQDPDTCEGGYKCQCEEGFQTKACK.... 101
66 -12.1001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  17  6....................................................................................................................................................PCFRANCEYQCQP------------LDQTSYLCVCAEGFAPIPHEPHRCQMTACPADCDPNTQASCECPEGYIGFICDECENGGFCSG-VCHNTFECICGPDSAGTDC..... 118
67 -11.9001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  30  4................................................................................................................................................................................................DMDECKEPDVCKHGQCINSYRCECPFGYIGNECDECSVGNPCGNGTCKNGFECTCEEGFEMMTCE.... 82
68 -11.8001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  26  1..............................................................................................................................................................................................NISQHQCVKKQCPQNSGCFEREECKCLLNYKGDKCVENPNPTCDADAKCTKKITCECTKPDSGIFCS.... 93
69 -11.7002wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  21  2.....................................................................................................................................................................................RCGEQGSNMECPNNLC----CSQYGYC-GMGGDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAE.... 72
70 -11.7002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  16  1...........................................................................................................................................................GVDPKHVCVDTRDIPKNAGCDGTKEWRCLLGYKKGEGNTCVENNTCDINNGGCDPTASCQNAES-----------------TENSKKIICTCKEPTPNAYYE.... 91
71 -11.7001wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  15  2....................................................................................................................................................RCGEQGSNMECPNNLC----CSQYGYC-GMGGDYCGKGCQNGACWTSKRCGS-QAGGATCTNN-QCCSQYGYCGFGAEYCGAGCCSQWGFCGLG-SEFCGGGCQSGACSTD.. 129
72 -11.4001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  23  4..............................................................................................................................................................................................................................PGCPSSYDGYCLNGGVCLDSYTCNCVIGYSGDRCQTRD. 46
73 -11.4002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  20  4................................................................................................................................................................................................SEHTCIDTNVPDNAACYRTEEWRCLLTFKGGKCVKDNNGGCAPEAECKNKIVCKCTKEGSGVFCS.... 90
74 -11.3004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  14  504.....................................................................................................................................................GGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDG---------HCDVVETQDINICPQD--CL-RGSIVGGHEPGEPRGIKAGYGTCNEEEKCFCEPEIQDPLCDELC. 606
75 -11.2001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  27  40.......................................................................................................................................................................................................................CLRKYKD-----------CIHGECLRAPSCICHPGYHGERCH.... 76

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.