current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst DVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQSGRLEVLFQLast
1 -55.3004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model  100  1DVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQSGRLEVLFQ 124
2 -52.4002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  85  4DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHILDA 127
3 -43.3005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  33  3QADPCA--SNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDTHECACLPGFTGQNCEENIDDCPGN 127
4 -42.2005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  40  38DVNECGEKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCT......... 153
5 -40.3004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  31  385KIDYCS--SSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQRGHGYVCECARSYGGPNCQFLLPELPPG 506
6 -39.6004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  40  3......CDPNPCENGGICLPGLGSFSCECPDGFTDPNCSSVVGPCTPNPCHNGGTCEDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKGG..... 136
7 -39.2001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  18  13......NLERECIEEKCSFEEAREVFENTEKTNEFWKQYVDGDQCEPNPCLNGGLCKDDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGADSKVLCSCTTGYRLAPDQKSCKPAVPF 130
8 -36.5004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  14  48........NIKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNTYAGSSAPWHPGGTWVAGTMTYAGEGPIGFKSQQADGGVYAGSSAPWHNGGVWVNGNMTYAGEGPIGFKGNSVAGNNYAVENQ 220
9 -35.3004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  15  37........DIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTGTSAPWQPGGVWVTGTTTYNGEGPIGFKSEVTDGDTYSVENQKSNDGGKTLSGTMTYNGEGPIGFRGTLTSPDTYTVENQ 210
10 -34.7001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  21  7......HLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGP. 124
11 -32.4001fax_L mol:protein length:96 FACTOR XA  ali model follow..  27  3DGDQCE--TSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHEEQASVVCSCARGYTLADNGKACIPTGPYPCGKQTLE.............................. 95
12 -31.4001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  24  11VLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSH....................... 113
13 -31.3001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  22  16ECMEETCSYEEAREVFEDSDKTNEFWNKYKDG----------DQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGP. 129
14 -31.1001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  20  14........ERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQHTGTKRSCRCHEGYSLLADGVSCTPTVE. 132
15 -30.9001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  27  1.....................ANSFLEEVKQGNLE------------RECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTR..... 86
16 -29.6004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  27  199..NRAICRQGCSPKHGSCKL---PGDCRCQYGWQGLYCD----KCIPHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTQPCLNGGTCSNGPDKYQCSCPEGYSGPNCEIV....... 305
17 -28.7004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  24  158SCSRLCKKRDDHFGHYECQP---DGSPSCLPGWTGKYCDQPI--CLSGCHEQNGYCSK---PDECNCRPGWQGPLC----NECIPHKGCRHGTCT---IPWQCACDEGWGGLFCDQAA...... 260
18 -28.5004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  21  2.....................................SEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTA..... 84
19 -27.9002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  27  58..NRAICRQGCSPKHGSCKL---PGDCRCQYGWQGLYCD----KCIPHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTQPCLNGGTCSNTPDKYQCSCPEGYSGPNCEI........ 163
20 -25.7001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  22  1.......................SYQVICRDEKTQMIYQ--QHQSWLRPVLRSNRV------EYCWCNSGRAQ-CHSVPVKSCSEPRCFNGGTCQQALSDFVCQCPEGFAGKSCEIDTR..... 89
21 -24.2004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  27  146.......................SYRVVCSDNYYGDSCSRLCKK--RDDHFGHYECQP---DGSPSCLPGWTGKYCDQPI--CLSGCHEQNGYCS---KPDECNCRPGWQGPLCNEAA...... 230
22 -22.0002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  31  44........RHSCGDGFCSRPN----MCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDD----HCLCQKGYIGTHCGQPV---CESGCLNGGRCV---APNRCACTYGFTGPQCE......... 136
23 -21.4002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  30  216........STTCFNGGTCFY---PGKCICPPGLEGEQCEISK----PQPCRNGGKCI---GKSKCKCSKGYQGDLCSKPV---CEPGCGAHGTCH---EPNKCQCQEGWHGRHCNKRYEASLIG 316
24 -20.7001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  21  1..................................GTSHLVKCAEKEKTFCVNGGECLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQ............................. 66
25 -20.2002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  26  1DSRGC---ARWCPQDSSCV---NATACRCNPGFSSFS--DDINECATLSCGKFSDCWNTEGSYDCVCSPGYEENTCQ-DVDECSSGQCDSSTVCFNTVGSYSCRCRPGWKGIPNNQKDTVCE.. 143
26 -20.1004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  26  196..PECNHLCTACMNNGVCHEDTG--ECICPPGFMGRTCEKACELCKQEGCKSYVFCLPDPYG--CSCATGWKGLQCNEACHDCKLRSCNNGEMCDRFQG---CLCSPGWQGLQCERE....... 321
27 -19.3001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  13  4AQQTCANNRHQCSVHAECRDYATGFCCRCVANYTGRQCVAEGSP-GKVKGRIFVGSSQVPVVFENTDLHSYVVMRSYTAISTIPETYSLLPLAPIGGIIGWMFAVEQDGNGFSITGGEFTRQAE 139
28 -18.4001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  32  1.............................................................................SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA. 46
29 -18.3001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  21  43EKNECKKETLGKA-ENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESGECLSEIQSAGCSCAIGKVEKKCKTGETACQLKCNTDNEVCKNVEGVYKCQCMEGFT.............. 169
30 -17.4001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  20  2DVNECLDPTTCI--SGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRTVILE-DIDECQEL 128
31 -16.9004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  42  2...........................................................................DIVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELL....... 43
32 -16.7001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  25  2DPDGCL--SNPCFPGAQCSSFPGSWSCFCPVGFLGNGTHEDLDECALVSTSKVPRCVNTQPGFHCPCPPRYRGNQPVEPENPCKDKNCHKHAECIFSDPMYKCECQTGYAGDGLICGEDSDLDG 152
33 -16.4003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  24  147.............................KEGFQG---------CLASVDLNGRLPDLISDALF---CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCNDPGTTYIF. 229
34 -15.9002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  34  3DIDECESSP----INGVCKNSPGSFICECSSESTLDPTKTICIETIKGTCWQTWGSPCTLCQVDPICGKGYSGTQCE-DIDECEVFPVCKNGLCVNTRGSFKCQCPSGMTGRIC.......... 146
35 -15.7001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  32  3.......................................VDMDECKEPDVCKHGQCINTDGSYRCECPFGYAGNECV-DTDECSVGNPCGNGTCKNVIGGFECTCEEGFEMMTCE......... 82
36 -15.5004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  16  370......RASLSNATAEQCGQRLMLSSADGSSLSSQVRGYHWATFVATDCNMGRGKCFFYSTVPECLIHAIDPDSIAVLPEDKCVSVDCGAHGTCDV--ATGKCVCEPGFTGERCDAAAL..... 505
37 -15.4001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  31  2DIDECRISPDLCGR-GQCVNTPGDFECKCDEGYEMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQ.................................................... 77
38 -15.3001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  24  1..........................................................................NSYPGCPSSYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCQTRDLRWWEL 52
39 -15.2005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  26  187RCRDQSRDRSLCHGKGFLECG----ICRCDTGYIGKNCECQTQGRSSQECSGLGDCVCG----QCLCHTSIYGQYCECDTINCERYNGPGRGLCFCG----KCRCHPGFEGSACQ......... 313
40 -15.0002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  15  76..........RSLDKGIMADPT---VNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEV--DVIVMNSEGNTILKTPQNAQAECPGGCRNGGFCN---ERRICECPDGFHGPHCEGT....... 181
41 -15.0003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  22  4GGSPCI--SQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECRTDGCQH--FCLPGQESYTCSCAQGYRHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVI...... 124
42 -14.5001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  32  1...............................................................................TASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE..... 40
43 -14.5002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  20  1..................MKPMSDYDIPTTENLYFQGAM-GTNECLDNNGGCSHVCNDLKIGYECLCPDGFAQRRCEDIDECQDPDTCSQ--LCVNLEGGYKCQCEEGFQ.............. 92
44 -14.1001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  18  1NISQHQCVKKQCPQNSGCFRHLEREECKCLLNYKQETCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSGIFCS............................................... 93
45 -14.0001z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  40  2DVDECSLKPSICGT-AVCKNIPGDFECECPEGYRSKSCE-DIDECSENMCAQ--LCVNYPGGYTCYC......................................................... 68
46 -13.8002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  24  2DVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLH-----------GEGPPPPVPPAQHPNPCPPGYE.................................................... 62
47 -13.8001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  18  1NISQHQCVKKQCPQNSGCFRHLEREECKCLLNYKQETCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSGIFCS............................................... 93
48 -12.8004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  25  453...NCDCQKEVEVNSSKCHHGNGSFQCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCYGNIYGPYCQCDNFSCVRHKCGGNGDCDCG----ECVCRSGWTGEYCNTSTDSCVSE 586
49 -12.7002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  12  8...........CDNIKRLPTKPDPPQWRCNDELEPSQCTAACKSCREAPGPFPGKLI---------CEDIYWGADPGPFCTPRPWGDCCDKAFCNKMNPP-TCRCMDE--VKECADACKDCQRV 108
50 -12.5001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  24  1..........................................................................NSYPGCPSSYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCE......... 43
51 -12.1002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  24  186.....................................CRCRDQSRDRSLCHGKGFLE------ICRCDTGYIGKNCECQTQSCRKDNCSGLGDCVCG----QCLCHTSIYGQYCE......... 274
52 -12.0003gcw_E mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  23  4GTNECLDNNGGCSY--VCNDLKIGYECLCPDGFQQRRCEDIDECQDPDTCSQ--LCVNLEGGYKCQCEEGFQ.................................................... 74
53 -11.8001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  22  9........................................SAHKCIDTNVPENAACYRYLDGEEWRCLLGFKGGKCVPASITCEENNCAPEAECTMDKKEVECKCTKEGSE............. 85
54 -11.7003ltf_D mol:protein length:58 Protein spitz  ali model follow..  23  2................................FPTYKCP---ETFDAWYCLNDAHCIADLPVYSCECAIGFMGQRCEYKEIDNTYLP..................................... 57
55 -11.5004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  19  5......SEEPRCPR-AACQAKRGD---RCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFRCDPACSSPACLYDNFDCHAGGHFADGRCDQGCNTEEC----GWDGLDCASEVPA.... 129
56 -11.4003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  22  971..............GGVAKETYKSLPVHAKEGFQG---------CLASVDLNGRLPDLISDALF---CNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCNDPGT..... 1066
57 -11.4003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  24  3PVDPCF--RANCEY--QCQPNQTSYLCVCAEGFAPIPHEPHRCQLFCNQTACPADC-DPNTQASCECPEGYIGFICTDIDECENGGFCSG--VCHNLPGTFECICGPDSA.............. 109
58 -11.4003cfw_A mol:protein length:164 L-selectin  ali model follow..  28  104......................................................................WNDDACHKLTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQ-FVQVDPR. 161
59 -11.2004ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  13  28...DCVKASDQCLKEQSCSTKYRTLRQCVAG--KETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKGMKKEKNCISKGNNCAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRR--KCHKA 190
60 -11.2002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  21  4........................................SEHTCIDTNVPDNAACYRYLDGEEWRCLLTFKGGKCPASNVTCKDNNCAPEAECKMTSNKIVCKCTKEGSE............. 81
61 -11.0004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  15  498..LECEECGGLGSPTGRCEWRQGDGK---GITRNFSTCSPSTKTCPD------GHCDVVETQDINICPQDCLRGSIGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPEIQDPLCD---ELCR.. 607
62 -11.0001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  24  3........................................SEHRCIDTNVPENAACYRYDGTEEWRCLLYFKAGKCPAPNMTCKDKNCAPEAECKMNKNEIVCKCTKEGSGVFCS......... 89
63 -11.0002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  15  303...............VSWENTRTKESCQAIKEYMDTNVTSGALLCSQALCSGHGRCVTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERK....... 413
64 -10.8003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  22  295..GRCKCNL----HATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGYLPIPKGAANACISISSIGTNVCDNELLHCQNGGTCHNNVR--------CLCPAAYTGILCE......... 397
65 -10.8004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  29  434...DCACQAQAEPNSHRCNNGNGTFECRCGPGWLGSQCESQQDECGQPVCSQRGECL------QCVCHSSITGKYCECDDFSCVRYKCSGHGQCSCG----DCLCDSDWTGYYCNCTTRT.... 564
66 -10.6001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  24  3PVDPCF--RANCEY--QCQPLDTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADC-DPNTQASCECPEGYIGFICTDIDECENGGFCSG--VCHNLPGTFECICGPDSA.............. 109
67 -10.6002gh0_A mol:protein length:213 GDNF family receptor alpha-3  ali model follow..  17  10..DLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHCLRQLLTFFEKAAEPHAQCPCAPNDRGCGCALPPVAPNCLELRRLCFSDP-----LCRSRLVDFQTHCHPMDILGTCATEQSRCLRA 141
68 -10.5005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  33  2................................................................................NPCCSHPCQNRGVCMSGFDQYKCDCTTGFYGENCST........ 39
69 -10.4004bxs_A mol:protein length:423 FACTOR X-LIKE PROTEASE  ali model follow..  27  46..DGDQCSSNPCHYRGICKDGIGSYTCTCLSGYEGKNCERVLYKVDNGNCWH--FCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSC.................................... 132
70 -10.2003v65_B mol:protein length:386 Low-density lipoprotein receptor-related prot  ali model follow..  27  2GEENCNVNNGGCAQ--KCQMIRGAVQCTCHTGYRGRTCQDVNECAEEGYCSQ--GCTNSEGAFQCWCEAGYERRSCKAL............................................. 84
71 -9.9001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  34  33...............................................................................VNPCCYYPCQHQGICVRFLDRYQCDCTTGYSGPNCTIP....... 72
72 -9.8801a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  27  2..............................................................................GAPSSYDGYCLNGGVAIESLDSYTCNCVIGYSGDRCQ......... 40
73 -9.7001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  42  16...........CLHDGVCIEALDKYACNCVVGYIGERCQ..................................................................................... 45
74 -9.6803eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  18  4.....ACELPECQGNKVCSLQCNNHAC----GWDGGDCSLNFQSLQCWKYFSDGHCDSQCNSAGC----LFDGFDCQRAEGQCNPKDHFSDGHCDQGCNSAEC----EWDGLDCAEHVPERLAA 127
75 -9.6702mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  23  12.........RDIPKNAGCFDDDGTKEWRCLLGYKKGEGNNNNPTCDINNCDPTASCQNAESTIICTCKEPTPNAYYE............................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.