current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4xl1_B mol:protein length:230 Delta-like protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst GSSSIFQLRLQEFANERGMLANGRPCEPGCRTFFRICLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNEAALast
1 -77.5004xl1_B mol:protein length:230 Delta-like protein  ali model  100  1GSSSIFQLRLQEFANERGMLANGRPCEPGCRTFFRICLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNEAA 230
2 -60.5004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  99  1.SSSIFQLRLQEFANERGMLANGRPCEPGCRTFFRICLKHYQATFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNECI 229
3 -41.9004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  37  1..SGQFELEILSMQNVNGELQNGNCCGGACDTYFKVCLKEYQSRTAGGPCSFGSGSTPVIGGNTFNLKA-SRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPD-----SIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCI 235
4 -34.2002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  14  101........SVVQVGFPCLGKQDGVAAFEVDV----------IVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRCECPDGFHGPHCEKALCTPRCMNGGLCTPGFCICPPGFYGVNCDKANCSTTCFNGG--TCFYPGKCICPPGLEGEQCEISKCPQP-CRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPG-CGAHGTCHEPNKCQCQEGWHGRHCNKRY 310
5 -32.1002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  38  2.........................................................................................................................................RGSGSIEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCI 94
6 -30.8004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  37  1.SSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCSPEPPCTYGSAVTPVLGVDSFS--LPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECI 238
7 -26.1004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  24  195......................GPECNHLCTA----CMNNGVCHEDTGECI----------------------------------CPPGFMGRTCEK----------------------------------------------------ACELHTFGRTCKERCSGQEGCKSYVFCLPPYGCSCATGWKGLQCNEACCKLRCCNNGEMCDRFQGCLCSPGWQGLQCEREG 322
8 -26.1004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  19  1................................................................................................................................DICDPNPCENGGICLPGSFSCECPDGFTDPNCSSVVETPNPCHNGGTCEIGYVCKCPRGFNGIHCQHNICEVEPCKNGGICTDNYSCECPGEFMGRNCQYKG 135
9 -25.2002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  25  55.................................................................................................................................................PNMCTCPSGQIAPSCGSRSIQNIRCMNGGSC-SDDHCLCQKGYIGTHCGQPVC-ESGCLNGGRCVAPNRCACTYGFTGPQCE... 136
10 -24.2004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  27  24.................................................................................................................................................SFECQCLQGYTGPRCEIDVNESNPCQNDATCLDEFQCICMPGYEGVYCEINTCASSPCLHNGRCVNEFLCQCPKGFSGHLCQSGR 118
11 -24.1002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  25  27.................................................................................................................................................SFECQCLQGYTGPRCEIDVNESNPCQNDATCLDEFQCICMPGYEGVHCEVNTCASSPCLHNGRCLNEFQCECPTGFTGHLCQVDL 121
12 -23.9002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  17  104.................................................................................................................................................QVGFPCLGKQDGVAAFE-VDVIVMNSEGNTILKTPQNAIFFKT----CQQAEC-PGGCRNGGFCNERRICECPDGFHGPHCEGT. 181
13 -23.9004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  2..........VDMTKTSKGFNNLQHVQNQWGGSSAPWHEGGMWVL---------GCRSGQNVVALNIKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNTYAVENQWGGSSAPWHPGGTWVIGCRVNQQVVALDIESGDQGATLAMTYAGEGPIGFKSQQADGGVGSSAPWHNGGVWNMTYAGEGPIGFKGNSVAGNNELYITSGDNGNTFHTYSGEGPIGFRAMALPQ.. 279
14 -23.9005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  32  64.................................................................................................................................................SYRCVCRATHTGPNCERPYVPPSPCQNGGTCDVTHECACLPGFTGQNCEENICPGNNCKNGGACVNTYNCRCPPEWTGQYCTE.. 157
15 -23.7005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  32  61.................................................................................................................................................SYRCVCRATHTGPNCERPYVPPSPCQNGGTCDVTHECACLPGFTGQNCEENICPGNNCKNGGACVDTYNCRCPPEWTGQYCTE.. 154
16 -22.7001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  17  1.................................................................................................................................................SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVE---YCWCNSGRAQCHSPVKSCSEPRCFNGGTCQSDFVCQCPEGFAGKSCEIDT 88
17 -22.1004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  10  52.................................................................................................................................................TYNGEGPIGFRGTLSSANNGTSAPWQPGGVWTTTYNGEGPIGFKSEVTDGDTGSAAPWHSGGVWVMTYNGEGPIGFRGTLTSPDT 204
18 -20.6002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  21  184....................................................................................................................................................CECR-------CRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCEEGSCRKD-CSGLGDCV--GQCLCHTSIYGQYCE... 274
19 -20.4001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  11  2................................................................................................................................................NSFLEEVKQGNLERECLEEACSLEEARE--------FEDAEQTDEFWSKYKDGCEGHPCLNQGHCKGDYTCTCAEGFEGKNCEFST 85
20 -20.3005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  24  207..................................................................................................................................................GICRCDTGYIGKNCECQTQGRSSCSGLGDCV--GQCLCHTSIYGQYCECDTINCERGPGRGLCFC-GKCRCHPGFEGSACQ... 313
21 -20.2001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  15  24.................................................................................................................................................EVFEDSDKTNEFWNKYKDGDQTSPCQNQGKCKDEYTCTCLEGFEGKNCELFTCSLDNGDCDQFCHESVVCSCARGYTLADNGKAC 119
22 -20.1001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  11  2................................................................................................................................................NAFLEELRPGSLERECKEEQCSFEEA-------REIFKDAERTKLFWISYSDGCASSPCQNGGSCKDSYICFCLPAFEGRNCETHK 85
23 -19.9001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  10  30.................................................................................................................................................EVFENTEKTNEFWKQYVDGDQPNPCLNGGLCKDSYECWCQVGFEGKNCELDANIKNGRCKQFCKTSKVLCSCTTGYRLAPDQKSC 124
24 -19.4001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  26  1.......................................................................................................................................................SKHVDGDQCLVL-PCASLCCGHGTCIDSFSCDCRSGWEGRFCQREVCSLDNGGCTHYCLEWRRCSCAPGYKLGDDLLQC 92
25 -19.2001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  17  2................................................................................................................................................NSFLEEMKKGHLERECMEETCSTSPCQNQGKCKDEYTCTCLEGFEGKNCELFTCSLDNGDCDQFCHESVVCSCARGYTLADNGKAC 124
26 -18.0004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  19  3.............................................................................................................................................................EKCFEPQLLRFFHKNEIRTEQAAVARCQCKGPDAHCQRQACRTNPCLHGGRCLEHRLCHCPVGYTGPFCDVDT 83
27 -17.3001fax_L mol:protein length:96 FACTOR XA  ali model follow..  21  4............................................................................................................................................................GDQCE-----TSPCQNQGKCKDEYTCTCLEGFEGKNCELFTCSLDNGDCDQFCHASVVCSCARGYTLADNGKAC 81
28 -17.1003i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model follow..  21  10......................................................................................................................................................CQEDAGNKVCSLQCNNHACGWDGGDCSLTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRDGHCSAECEWDGLDCAEHV 121
29 -16.5002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  17  20.................................................................................................................................................PPQWRCNDELEPSQCTAAC---KSCREAPGPF-PGKLICEDIYWGADPGPFCTPRGDCCDKAFCNKMNPPTCRCMDEVKECADA. 101
30 -16.0003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  21  9......................................................................................................................................................CQEDAGNKVCSLQCNNHACGWDGGDCSLTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQSDGHCSAECEWDGLDCAEHV 120
31 -15.6003cfw_A mol:protein length:164 L-selectin  ali model follow..  23  87............................................................................................................................................................KEDCVEIYIKRNKDAGKW---NDDACHKLKAAL---CYTASCQPWSCSGHGECVNNYTCNCDVGYYGPQCQFVQ 157
32 -14.9002ddu_A mol:protein length:387 reelin  ali model follow..  16  181........................................................................................................................................................PPFGLDGVYISEPCPSYCSGHGDCI-SGVCFCDLGYTAAQGTCVSNTPNHSRFEGKL-SPLWYKITGGQVGTGCGTLN 260
33 -14.8005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  11  313..................................EIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC----IQEQSFVIRALGFTDIVTVQVLPQCECR-------CRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCE---PAALQAQGKKKLQALKKKNAQLKWKLQALK... 498
34 -14.8003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  17  147.......................................................................................................................................................KEGFQG--CLASVD------NGRLPDLISDALFCNGQIERGCESTTCQEDSCSNQGVCLDGFSCDCSTSFSGPLCNDPG 224
35 -14.7005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  20  183....................................................................................................................................................................................QCEC-------RCRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCE... 221
36 -14.6005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  12  417.....VQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTS---------DVPGKLIYGQYCECDTINC-----------ERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCCSGRGRCR--NVCECHSGYQLPLCQECPGCPSPCGKYISCAE---LKFEKGPFGKNCSAAC 625
37 -14.3003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  35  422............................................................................................................................................................................NGYCTPTGKCCCSPGWEGDFCRTAKCEPA-CRHGGVCVRPNKCLCKKGYLGPQCE... 475
38 -14.2003eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  21  10......................................................................................................................................................CQEDAGNKVCSLQCNNHACGWDGGDCSLTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQSDGHCSAECEWDGLDCAEHV 121
39 -13.8003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  18  294...............................................................................................................................RGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCCIPSISSIGTNVCDNNVRCLCPAAYTGILCEKLRCEEA-----GSCSDSGQGAPPHG.......... 419
40 -13.6004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  14  242......GMKDSSWITGPFECSILSRCTTHCYKSGGNCFRSLPADMSTGECRLLGYHTQDFRSSTCAELTTD-DTNAFYCVRPMKTAASSNMVYVTSHTRPDHETKCPPREPLKNVRWGVVSKGKYCKPMNARASLSNATAEQCGMLSSADGSSLSSQVRGYHWATFATDCNMGESCAATARGKCFFYSTVPECPEDKCVSVDCGAHGTCDATGKCVCEPGFTGERCDAAA 504
41 -13.6004aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  16  280.............HCMCRHNTKGLNCEL-CMDFYHDLPWRPAEGRNSNACK----KCNCNEHSSSCHFDMAVFLATGNVSGGVCDCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDG--YTDFSVGLIAGQCRCKLHVEGERCDVCCNPLGTIPGGNPCDSTGYCYCKRLVTGQRCDQCLCRPCDCDLGGACSESGQCSCLPHMIGRQCNE.. 525
42 -13.5004wnx_A mol:protein length:433 Netrin-4  ali model follow..  24  261.................................................................................................................................................HGRCMCKHNTAGSHCQHCCRTCKCNGHADTCHSGGVCNCQHNTEGQHCQRDACKACSCHPVGSCDPNGDCPCKPGVAGPHCDRCM 406
43 -13.3001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  24  1.............................................................................................................................................................................................GTSHLVKCKEKTFCVNGGECFSRYLCKCQPGFTGARCTENV 51
44 -13.1004urt_A mol:protein length:420 NETRIN-1  ali model follow..  24  261...............................................................................................................................................DDSLVCDCRHNTAGPECDRCCVACNCNLHARRCRSGGVCLCRHNTAGRHCHYKACKACDCHPVGACQTTGQCPCKDGVTGITCNRC. 399
45 -13.1004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  16  449.....................................................SPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCE--------------------CGEDMLSTDSCKEAPDHPSCSGRGDCY---GQCICHLSPYGNIYGPYCQCDN-CGGNGDCD--GECVCRSGWTGEYCNCTTSTDSCCSGRGDCV--GKCVCNPGASGPTCERC. 617
46 -13.0001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  24  73.................................................................................................................................................MYKCGCIEGYTEDTCVLDVCQYKNCGESGECIQSAGCSCAIGKVEKKCGETACQLKCNTDNEVCKNVYKCQCMEGFTKNVC.... 177
47 -12.9004ove_A mol:protein length:437 Netrin-1  ali model follow..  24  277...............................................................................................................................................DDSLVCDCRHNTAGPECDRCCVACNCNLHARRCKSGGVCLCRHNTAGRHCHYKACKACDCHPVGACNQTGQCPCKDGVTGITCNRC. 415
48 -12.7002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  21  9........................................................................................................................................CPQDSSCVNATACRCNPGFSSFSCDDITLSKVSCGKFSDCWNSYDCVCSPGYEENTCDVDECSSGQCDSSTVCFNSYSCRCRPGWKPRVCE... 143
49 -12.6004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  15  361DLPEELSLSFNATCLNNEVIPGLKSCMGSIEAKVRGCPQEKEKSFTIKPVGFKDSLCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDE----------------CSPREGQPVCSQRGECLC---GQCVCHSSDFGKITGKYCECDD-CSGHGQCS--GDCLCDSDWTGYYCNCTTRTDTCMSSNGLCSGRGKCECQPGSYGDTCEKC. 601
50 -12.4004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  12  417.....VQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVP--------------------GKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCCSGRGRCR--NVCECHSGYQLPLCQECPGCPSPCGKYISCAE---LKFEKGPFGKNCSAAC 625
51 -12.4002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  24  5...............................................................................................................................DECESSPCINGVCKNSPGSFICECSSESTKTICSQCCSSLGAAWGSPCTLCQVDPICGKGYSGTQCDIDECEVFPVCKNGLCVNSFKCQCPSGMTGRIC.... 146
52 -12.4004plm_A mol:protein length:432 Netrin-1  ali model follow..  24  276...............................................................................................................................................DDNLVCDCKHNTAGPECDRCCVACNCNLHARRCRSGGVCLCRHNTAGRHCHYKACKECDCHPVGACNQTGQCPCKDGVTGITCNRCA 415
53 -12.3003ltf_D mol:protein length:58 Protein spitz  ali model follow..  16  2...........................................................................................................................................................................................FPTYKCPETFD-AWYCLNDAHCFPVYSCECAIGFMGQRCEYKE 50
54 -12.3004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  22  504......................................................................................................................................................GGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDG----HCDVNICPQDCLRGSGTCNEEEKCFCEPEIQDPLCDELC 606
55 -12.2002oo4_A mol:protein length:234 Neurogenic locus notch homolog protein 2  ali model follow..  13  1...............................................................................................................................GATCLSQYCADKARDGVCDEACSHACQWDGGDCSTMENPWANCSSPLPCWDYINNQCDELFDNFECQGNSKTCADHFKDNHC-NQGCNSEECGWDGLDCAADQ 117
56 -12.2001npe_B mol:protein length:164 Laminin gamma-1 chain  ali model follow..  24  23....................................................................................................................................................THCPTGTAGKRCELCCNDNIDPNAVGNCNRTGECLCIYNTAGFYCDRDKCKACACNPYGTCNPTGQCQCLPHVSGRDCGTCD 150
57 -12.1004mzv_A mol:protein length:248 Epithelial cell adhesion molecule  ali model follow..  12  3...................................................................................................................................................ECVCENYKLAVNCFV--------------NNNRQCQCTSVGAQNICSKPDCDESGLFKAKQCQGTSTCWCVNTAGVRRTDKDT 108
58 -11.9001g1q_A mol:protein length:162 P-SELECTIN  ali model follow..  21  87............................................................................................................................................................NEDCVEIYIKSPSAPGKW---NDEHCLKKKHAL---CYTASCQDMSCSKQGECLENYTCSCYPGFYGPECEYVR 157
59 -11.8004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  20  9...................................................................................................................................................RCPCQAKRGDQRCDRECNSPGCGWDGGDCSLSRQCECWRLFNNSRCDPACSSPACLYDNFDCHADGRCTEECGWDGLDCASEV 127
60 -11.5001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  27  5.................................................................................................................................................................................................GCPSSYDGYCLNGGVCLDSYTCNCVIGYSGDRCQTRD 46
61 -11.4003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  24  23.................................................................................................................................................SYLCVCAEGFAPHRCQLFCNQ-TACPADCDPNTQASCECPEGYIGFICTD-----DECENGGFCSGTFECICGPDSA........ 109
62 -11.3002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  18  1............................................................................................................................................................GVDPKHVCVDTRDIPKNAGCDGTEEWRCLLGYKKGEGNTCVENNGGCDPTASCQNKIICTCKEPTPGVFCSS.. 97
63 -11.3002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  19  1............................................................................................................................................................GVDPKHVCVDTRDIPKNAGCFRDDEWRCLLGYKKGEGNTCVENNGGCDPTASCQNKIICTCKEPTPGVFCS... 96
64 -11.3001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  25  23.................................................................................................................................................SYLCVCAEGFAPHRCQMFCNQTA-CPADCDPNTQASCECPEGYIGFICTD-----DECENGGFCSGTFECICGPDSAGTDC.... 118
65 -11.3001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  29  40.......................................................................................................................................................................................CLRKYKD-FC------------HGECLRAPSCICHPGYHGERCH... 76
66 -11.2001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  20  1..............................................................................................................................................................NISQHQCVKKQCPQNSGCDEREECKCLLNYKGDKCPNPTCNNGGCDADAKCTEKITCECTKPDSGIFCS... 93
67 -11.1001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  20  1..............................................................................................................................................................NISQHQCVKKQCPQNSGCDEREECKCLLNYKGDKCPNPTCNNGGCDADAKCTEKITCECTKPDSGIFCS... 93
68 -11.1001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  17  12......................................................................................................................................CISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNGDTACSNE-LCPGGEGFRTVILDIDECQELPLCQGGKCINSFQCRCPTGYYTRVCD... 162
69 -11.1001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  27  2.................................................................................................................................................................................................DGDQCASSPCQNGGSCKDSYICFCLPAFEGRNCETHK 41
70 -11.1002y38_A mol:protein length:403 LAMININ SUBUNIT ALPHA-5  ali model follow..  19  272....................................................................................................................................ADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPKPATTDSANECQS---CNCHGHAYDCYYDPEVDRREASQNQDNVQGGGVCLCQHHTTGINCERCL 375
71 -11.0001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  27  1..................................................................................................................................................................................................TASCQDMSCSKQGECLENYTCSCYPGFYGPECEYVR 39
72 -11.0004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  31  5.................................................................................................................................................................................................DGDQCESNPCLNGGSCKDSYECWCPFGFEGKNCEL.. 42
73 -10.8001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  28  5.................................................................................................................................................................................................GCPSSYDGYCLNGGVCLDSYTCNCVIGYSGDRCEH.. 44
74 -10.7005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  23  4....................................................................................................................................................MSCIPGESSDNCTALVQTEDNP----RVAQVSITKCSSDMNG-YC------------HGQCMSQNYCRCEVGYTGVRCE... 71
75 -10.7004aqt_A mol:protein length:375 LAMININ SUBUNIT GAMMA-1  ali model follow..  21  269...............................................................................................................................................FDKLMCNCKHNTYGVDCEKCLPRRATAESASECLP---CDCNG--RSQECYFDPELYRSTGHGGHCTN-----CRDNTDGAKCERC. 351

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.