current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MAMTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKTDGESVEQSWQRHQLTLIPQGRAQTPEDMGRLALFFATMDNVTGQAVNVDGGFTFHLast
1 -106.0004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model  100  1MAMTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKTDGESVEQSWQRHQLTLIPQGRAQTPEDMGRLALFFATMDNVTGQAVNVDGGFTFH 260
2 -95.9003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  40  3...HMSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMAEITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSDYMTGQSVLIDGGLVFR 262
3 -95.6004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  36  1....MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVL-----------DGMTSSCWLRRLAEPAEIASIYAFLASDSYVNGVAIEASGGMSL. 246
4 -95.4001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  40  2........KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDYMTGQSLLIDGGMVFN 256
5 -95.0003wye_A mol:protein length:256 Diacetyl reductase [(S)-acetoin forming], L-2  ali model follow..  42  2........KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGHGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQTAARDLAPLGITVNGYCPGIVGTGMWEQIDAELSKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASSDYMTGQSLLIDGGMVFN 256
6 -94.7002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  40  2......LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYANEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIK-----------AEMLKLIPAAQFGEAQDIANAVTFFASDKYITGQTLNVDGGMVM. 246
7 -94.3002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  41  1....MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVK-----------EMYLNNIPLKRFGTPEEVANVVGFLASDNYITGQVINIDGGLVM. 247
8 -94.3004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  35  1.SMMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAAAEI---GPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGRGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDALFARYENRPRGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASADYIVSQTYNVDGGNWMS 259
9 -94.2001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  36  1....MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFADYENLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPDYIVAQTYNVDGGNWMS 256
10 -94.2003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  41  4MAGIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIWEAELRGMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDRFMTGQGINVTGGVRMD 263
11 -93.8003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  36  2......SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYASKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELK-----------EQMLTQIPLARFGQDTDIANTVAFLASDKYITGQTIHVNGGMYM. 246
12 -93.6004jro_A mol:protein length:271 FabG protein  ali model follow..  41  15QSNAMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTK-----------EAMLAQIPLGAYGTTEDIANAVLFLASDKYITGQTLSVDGGMVM. 265
13 -93.5001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  34  1........SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYASAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDME-----------KKILGTIPLGRTGQPENVAGLVEFLALSPYITGQAFTIDGGIAI. 244
14 -93.1003woh_A mol:protein length:251 SiaM  ali model follow..  38  3MTGPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKRSGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK-------------RLDPVPMRRFGRPDEVAGLVAFLAGDSYITGQVVCVDGGMAM. 251
15 -92.9003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  42  2........SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAELSKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASENYVTGQVMLVDGGMLYN 258
16 -92.3004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  1..MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVI-----------EKMKAQVPMGRLGKPEDIANAYLFLASHDYVNGHVLHVDGGIMM. 244
17 -91.9004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  28  15QSNAMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELK-----------ADYVKNIPLNRLGSAKEVAEAVAFLLSDSYITGETLKVNGGLYM. 265
18 -91.5004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  29  11FQGMNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIM-----------EGYLKALPMKRMLEPEEIANVYLFLASDSGITATTVSVDGAY... 260
19 -91.3001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  35  13.SHMATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAVTAQALNVCGGLGN. 274
20 -91.1004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  38  1...MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYASSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNA--------------EPILQFIPLARYGQPEEVAGTIRFLATDPYITGQTFNVDGGMVM. 246
21 -91.0004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  36  1....MSTDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKYGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVL-----------EAMVARTPVGRIGDPVDIARAYLFLASEEFISGTTLSVDGGMVV. 255
22 -90.8004cql_B mol:protein length:244 CARBONYL REDUCTASE FAMILY MEMBER 4  ali model follow..  32  1......MMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDL---GGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKE--------------EHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQL. 236
23 -90.5003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  30  1....MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQK-----------SFIATKIPSGQIGEPKDIAAAVAFLASEEYITGQTLHVNGGMYM. 246
24 -90.3003sju_A mol:protein length:279 Keto reductase  ali model follow..  36  11.RGSHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRAMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVREGYARHWGVTEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDASITAQALNVCGGLGN. 272
25 -90.2002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  32  27.NYYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIK-----------KNIISNIPAGRMGTPEEVANLACFLSSDGYINGRVFVIDGGLS.. 274
26 -90.0001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  31  1..MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELQAKVGSQPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDFMTGVNLPIAGG.... 262
27 -89.9004qec_A mol:protein length:248 ElxO  ali model follow..  27  2........KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEIDS--------GEFSEDSISSIHPMQKLGTTLDVAKGIYFLANENFITGHVLSIDGGYLSQ 248
28 -89.9003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  31  4YESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATV----------LTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAWISGQVLTVSGGGVQE 254
29 -89.8001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  34  1....MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAVGAHP-----VVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVR-----------EKAIAATPLGRAGKPLEVAYAALFLLSDEFITGQVLFVDGGRTI. 240
30 -89.8004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  35  1...MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLG---------DLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLL-----------DKFAALTMLNRLGQPEEIAKVALFLASDSYVTGQTINVNGGMRL. 240
31 -89.8001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  29  6...NLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSV----------ITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPSWVSGQILTVSGGGVQE 253
32 -89.7004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  39  17...ALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAA--------------EKLLEVIPLGRYGEAAEVAGVVRFLAADPYITGQVINIDGGLVM. 262
33 -89.6004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  33  4.QLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVV-----------DKITEMIPMGHLGDPEDVADVVAFLASEGYITGTSVEVTGGLFM. 261
34 -89.6003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  35  14GSMDKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQ-----------TALKTQIPLGRLGSPEDIAHAVAFLASPQYITGTTLHVNGGMFMS 264
35 -89.4002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  34  1..MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGEAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIK-----------QKYKEQIPLGRFGSPEEVANVVLFLCSELYITGEVIHVNGGM... 247
36 -89.4004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  32  13YFQSMSLQGKVALVTGASRGIGQAIALELGRLGAVVIGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQR-----------EALLGQIPLGRLGQAEEIAKVVGFLASDGYVTGATVPVNGGMYM. 262
37 -89.4003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  30  4...SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTAAWLY---SNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANR----------TTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEWITGQIFNVDGGQIIR 252
38 -89.1003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  34  1...TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI---GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAF----------GFVEMLQAMKGKGQPEHIADVVSFLASDDWITGQTLNVDAGMVRH 247
39 -89.0002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  37  2.........RKALITGASRGIGRAIALRLAEDGFALAIHYGNREKAEEVAEEARRRGSPLVAVGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVK-----------EAYLKQIPAGRFGRPEEVAEAVAFLVSEKYITGQTLCVDGGLTPH 245
40 -88.9002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  33  1..MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVV-----------DKITEMIPMGHLGDPEDVADVVAFLASEGYITGTSVEVTGGLFM. 257
41 -88.9005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  28  1...MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAL----------ENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDYVTGMIHEVAGGFALG 252
42 -88.7003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  29  2......EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYASKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNR---------EDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKMIRGQTIIVDGGRSL. 248
43 -88.7003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  33  3.GSMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL---GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQK-----------DAIMGNIPMKRMGVGADIAAAVVYLASDEYVTGQTLHVNGGMAM. 248
44 -88.6004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  31  2..LSLGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATDGG----------NTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYERKAGSIVAISSISGERGNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIR-----------EKITKEIPFRRFGKPEEIAWAVAFLLSPSYVTGEVLRVNGAH... 238
45 -88.4004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  32  3...TQDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGGEGRVL--NSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQRAGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETR-----------QTFTAQTALGRFGDAQDIADAVLFLASDQYITGQTLHVNGGMLM. 247
46 -88.3002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  38  1..MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADL--VPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLQ---------AIPRLQVPLDLTGAAAFLASDDFITGQTLAVDGGMVRH 249
47 -88.2003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  27  1..MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVL-----------EKIVATIPVRRLGSPDEIGSIVAWLASEEFSTGADFSLNGGLHM. 249
48 -88.1003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  37  3.GSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYI-----------ASMARSIPAGALGTPEDIGHLAAFLATKEYITGQAIAVDGGQVL. 253
49 -87.9004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  30  1....MAMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGWGRIVNISSVNGSKGSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILD----------TKILPQIPAGRLGKPEEVAALVAYLCSEEFVTGSNIAINGGQHMH 249
50 -87.9003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  34  4MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL---GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQR-----------TATLAQVPAGRLGDPREIASAVAFLASPEYITGETLHVNGGMYM. 250
51 -87.8003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  30  14.GSMFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL---GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLNEKQK-----------EAIMAMIPMKRMGIGEEIAFATVYLASDEYLTGQTLHINGGMAM. 259
52 -87.7003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  30  1MGMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFAD---------PVQRADVESMIPMGYIGKPEEVAAVAAFLASSSYVTGITLFADGGMTKY 255
53 -87.5005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  30  2...MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPAL-KAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNR---------PGGTDWFMNRVMMKRIGETSEVVDPVVFLASPSYITGTILPVDGGFLA. 250
54 -87.4004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  27  12LYFQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESAL------------KEAMSMIPMKRMGQAEEVAGLASYLMSDIYVTRQVISINGGML.. 261
55 -87.4003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  26  4....SGSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVL-----------DKIVATIPVKRLGLPEEIASICAWLSSEEFSTGADFSLNGGLHM. 250
56 -87.1004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  26  13LYFQGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVL-----------DKIVATIPVKRLGLPEEIASICAWLSSEEFSTGADFSLNGGLHM. 263
57 -87.0003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  36  28.KVMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGRGRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYI-----------SGMARSIPMGMLGSPVDIGHLAAFLATDEYITGQAIVVDGGQVL. 278
58 -87.0004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  32  1..MAMRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFS-DHGQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQGGGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNIPDDKK-----------QALVALHPMGRLGRAEEVANAVLFLASDEFVNGASLLVDGGYTAQ 248
59 -87.0005cdy_A mol:protein length:244 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  28  1....MSFEGKIALVTGASRGIGRAIAELLVERGACVIGTATSEKGAEAISAYL---GENGKGLMLNVVDPTSIDTVLATIRAEFGEVDILVNNAGITRDNLLMRMKDDEWQDIIDTNLTSVFRLSKAVMRAMMKKRFGRIITIGSVVGTMGNAGQVNYAAAKAGVIGFSKSLAREVASRGITVNVVAPGFIETDMTRTLTDDQR-----------AGILAQVPANRLGDAKEIASAVAFLASDEYISGETLHVNGGMYM. 243
60 -87.0001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  30  1....MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQR-----------AGILAQVPAGRLGGAQEIANAVAFLASDEYITGETLHVNGGMYM. 243
61 -87.0004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  32  13LRLRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVAGKTYSPVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVN-----------AEQVKLTPMARLGQPAEVADVALWLTSTSFVTGQTVDVAGGLYM. 266
62 -86.9003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  30  3...MIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNAL---KDNYTIEVCNLANKEECSNLIS----KTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEKQR-----------EAIVQKIPLGTYGIPEDVAYAVAFLASNNYITGQTLHVNGGMLM. 242
63 -86.9001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  30  1..MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFAD---------PEQRADVESMIPMGYIGEPEEIAAVAAWLASSSYVTGITLFADGGMTQY 253
64 -86.9001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  30  1..MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFAD---------PEQRADVESMIPMGYIGEPEEIAAVAAWLASSSYVTGITLFADGGMTL. 252
65 -86.6003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  29  11QGPGSMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSRNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLE----------AKILPQIPVGRLGRPDEVAALIAFLCSDDFVTGADLAINGGMHMS 263
66 -86.4004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  28  1MAMGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDREGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIQREYHGA----PANWLEEAVKTQPFGRLLDPAKVARAIAFLASEELMTGAIVNFDQSVWG. 259
67 -86.2003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  14FQSMQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG-----------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFAKRGFD----PDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAYLCGSLVEVNGGKAV. 259
68 -86.2003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  29  2..KPYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQRGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRADAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREERELDWAQWTAQARNKQIPLGRLGKPIEAARAILFLASPAYTTGSHIDVSGGLSRH 264
69 -86.1002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  30  1...MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE------AIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALSPD-----PERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKFITGAILPVDGGMTAS 248
70 -86.1003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  24  1..MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEAR-----------QLKEHNTPIGRSGTGEDIARTISFLCEDDMITGTIIEVTGAVDV. 253
71 -85.9003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  23  4.SMGGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVPSKPFANTTFEHMRDAIELTVFGALRLIQGFTPAL-EESKGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEHQAGKYGTSVEDIYNAAAAGSDLKRLPTEDEVASAILFMASDSGITGQALDVNCGEYK. 263
72 -85.8003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  30  8...KLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICSEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKQGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEK---------PELYDAWIAGTPMGRVGQPDEVASVVQFLASDSLMTGAIVNVDAGFTV. 259
73 -85.8004npc_A mol:protein length:265 Sorbitol dehydrogenase  ali model follow..  34  10IDLNFPLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISADIAKAKAEEL---GENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGNGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGKYGICVNTLSPTIVLTELGKKA----------WAGEKGEAAKKRIPAGRFAYPEEIAAAAVFLASADMITGADLLIDGGYTI. 258
74 -85.6003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  30  20......LKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKT----------SSSELLDRLASDEAFGRAAEPWEVAATIAFLASDSYMTGEVVSVSSQRA.. 266
75 -85.6004yxf_A mol:protein length:257 MupS  ali model follow..  30  13HDSAPSAVKGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSE----RADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDMVKDLSPQTL-----------SRIERRTPLGRLGTQQEVADLILYLVDRTFVTGQNIAVDGGFTC. 257

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.