current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MFSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASAKASGTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITGQILDVNGGQICPLast
1 -111.0004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model  100  1MFSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASAKASGTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITGQILDVNGGQICP 258
2 -110.0004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  97  1MFSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASAKASGTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITGQILDVNGGQICP 258
3 -106.0003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  67  1MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYK. 257
4 -106.0004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  64  1MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYK. 257
5 -96.5003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  33  3.LQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKG-------GAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTFTPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAA-YVTGACYDINGGVLF. 250
6 -93.7004yqy_A mol:protein length:270 Putative Dehydrogenase  ali model follow..  35  18...DLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEG-------SSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPK-IRVNSLCPGMIDTDFHNIFTPEVRTHVANVSPVKREGTSEDVAKLAVFLASDDAA-FITGANVDINGGMLF. 263
7 -93.4003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  5.MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAG-VFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIAS-----GSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAG-YITGQAIAVDGGQVLP 254
8 -91.3001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  27  1......SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAG-ITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKK-----RKGRIINIASVVGLIGNI-GQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI. 244
9 -90.9002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  31  2....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAG-VTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQ-----RHGRIVNIASVVGVTGNP-GQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSK-YITGQTLNVDGGMVM. 246
10 -90.5002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  32  2...QLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAG-ITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQ-----KSGKIINITSIAGIIGNA-GQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSN-YITGQVINIDGGLVM. 247
11 -90.1003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  30  2....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQ-----RSGAIINLSSVVGAVGNP-GQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAK-YITGQTIHVNGGMYM. 246
12 -89.9003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  29  29VMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAG-IFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTAS-----GRGRVILTSSITGPVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAG-YITGQAIVVDGGQVLP 279
13 -89.8004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  28  2...KLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCD-VQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAG-ITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQ-----GKGVILNASSVVGLYGN-FGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDAS-YVNGVAIEASGGMSL. 246
14 -89.7004jro_A mol:protein length:271 FabG protein  ali model follow..  29  18.AMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAG-ITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQ-----RAGKIINMASVVGLIGNA-GQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASK-YITGQTLSVDGGMVM. 265
15 -89.4004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  27  5LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAG-ITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGC----RGSIINISSIVGKVGN-VGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASED-SGYITGTSVEVTGGLFM. 261
16 -89.3002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  28  1MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAG-ITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGC----RGSIINISSIVGKVGN-VGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASED-SGYITGTSVEVTGGLFM. 257
17 -89.0003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  23  1MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAG-VFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQ-----NFGRIINYGGADSAPGW-IYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDD-SDMITGTIIEVTGAVDV. 253
18 -88.9004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  26  3MGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAG-LTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVE----GAIVNVSSMSSMGGQ-PFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEE-SGLMTGAIVNFDQSVWG. 259
19 -88.8004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  31  18.AMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAG-VVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKS-----RFGSVVNVASIIGERGNM-GQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSS-YITGETLKVNGGLYM. 265
20 -88.3004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  23  15LRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHNKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEA-----RRGWIVNTSSVAGKTYSPIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAEQVKLTPMARLGQPAEVADVALWLTSTESS-FVTGQTVDVAGGLYM. 266
21 -88.1004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  29  1.MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAG-ITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQ-----KSGRIINITSVAGMMGNP-GQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNAE---PILQFIPLARYGQPEEVAGTIRFLATDPAAAYITGQTFNVDGGMVM. 246
22 -88.0004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  27  2...STDKRVAIITGAANGIGRATALEFAQAGYHV-VAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAG-VKGGEVVKKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAA-----KYGRILNASSVVGLYGN-FGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESG-FISGTTLSVDGGMVV. 255
23 -87.9004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  32  1MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN-----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAG-ITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQ-----GKGKIINTSSVTGTYGN-VGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESD-YVNGHVLHVDGGIMM. 244
24 -87.9003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  27  7.PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDL-KSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAG--GGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKA-----GGGAILNISSMAGENTN-VRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAA-WISGQVLTVSGGGVQ. 253
25 -87.4005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  28  1.MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAAR-SEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNLDKNLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVG-----GGSIVNISTIGSVVPD-ISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDD-SGYVTGMIHEVAGGFALG 252
26 -87.3003woh_A mol:protein length:251 SiaM  ali model follow..  31  5GPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAG-IIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRK-----RSGSIINISSVSGVFGSA-GQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK--RLDPVPMRRFGRPDEVAGLVAFLAGDESS-YITGQVVCVDGGMAM. 251
27 -87.0003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  25  5MGGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAAR-TVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVPSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEESK------GAVVNVNSMVVRHSQ-AKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYVEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLAS-GITGQALDVNCGEYK. 263
28 -86.8004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  26  14.MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFG-ETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAG-ITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDA-----KKGVIINTASVTGIFGS-LSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLAS-GITATTVSVDGAY... 260
29 -86.8003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  22  2....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAA-SGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKN-----GGGHIVSISSLGSIRYL-ENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSK-ADMIRGQTIIVDGGRSL. 248
30 -86.7001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  29  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAG-LENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVEN----DIKGTVINMSSVHEKIPW-PLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEAS-YVTGITLFADGGMTL. 252
31 -86.5003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  28  7.IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAV----VAGLENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAG-VSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLAS----NTKGVIVNTASLAAKVGA-PLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQERTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDA-ARFMTGQGINVTGGVRM. 262
32 -86.4001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  29  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAG-LANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVEN----DIKGTVINMSSVHEKIPW-PLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEAS-YVTGITLFADGGMTQ. 252
33 -86.4004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  26  14FQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAG-IARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGAR----QGGRIITLSSVSGVMGNR-GQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKE-AMSMIPMKRMGQAEEVAGLASYLMSDIAG-YVTRQVISINGGML.. 261
34 -86.3004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  30  17.ALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAG-ITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQ-----RSGRIINIASVVGEMGN-PGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAAE---KLLEVIPLGRYGEAAEVAGVVRFLAADPAAAYITGQVINIDGGLVM. 262
35 -86.3002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  28  1MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAG-ITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQ-----RWGRIVNISSVVGFTGNV-GQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELAS-YITGEVIHVNGGMF.. 248
36 -86.2005iz4_A mol:protein length:271 Putative short-chain dehydrogenase/reductase  ali model follow..  30  3.MTQSSTPVCVITGSASGIGAATALRFAQAGWSVAIGNDSTRDAASTVEALCRDAGAQTLIFDADVGKDADCRHAVDMVASRWQRIDALINCAG-VIPHNAFDQIDDFEFERVYRVNLIGLYQMTRAAVPLLRESASAT-RSTSVVNVSSLAGLNGTG-SSIAYAASKGAVNTLTLSLARNLAPH-IRVNALAPGMVDDGLLLRVYDGVLSRMTESAPLKRVSRPAEIAELAWFLTAH--APAITGQVIAAENGLLL. 262
37 -86.1004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  32  3.TQDLSGKIALVTGASRGIGAAIADTLAAAGAKV-IGTATSESGAAAISERLAQWGGEGRVL--NSAEPETVENLIADIEKTFGKLDILVNNAG-ITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQ-----RAGRIINITSVVGVMGN-AGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAK-YITGQTLHVNGGMLMP 248
38 -86.1003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  22  1MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAG-ITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVER-----GWGRIINISSVNGQKGQ-FGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEE-SGFSTGADFSLNGGLHM. 249
39 -86.1003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  28  3MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAG-VENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVEN----DIKGNVINMSSVHEMIPW-PLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQAS-YVTGITLFADGGMTK. 254
40 -86.0001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  23  1MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDM-NREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-----YGRIVNTASMAGVKGP-PNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSS-FMTGVNLPIAGG.... 262
41 -86.0003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  28  4.SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADI-NAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAGGMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKR-----GGGAIVNQSSTAAW----LYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEAS-WITGQIFNVDGGQII. 251
42 -85.8004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  26  2LSLGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATD-----------GGNTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAG-ITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYER-----KAGSIVAISSISGERGNV-GQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPVASSYVTGEVLRVNGAH... 238
43 -85.8001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  29  8...RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAG--GGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-----GGVILTITSMAAENKN-INMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAAS-WVSGQILTVSGGGVQ. 252
44 -85.6004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  30  1.MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGD----------LGDLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAG-ITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTN-----GYGSIINISSVVGVFGN-IGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDAS-YVTGQTINVNGGMRL. 240
45 -85.4004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  25  9RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPR------LAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGKGRSARIITIGSVNSFMAE-PEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSS-FITGSTITIDGGLSA. 260
46 -85.4001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  29  2...RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATA----AEIGPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAA-LFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAG----GRGGKIINMASQAGRRGE-ALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPE-ADYIVAQTYNVDGGNWM. 255
47 -85.2002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  31  2.......RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVAVGANLLEAEAATALVHQAAEVLGGLDTLVNNAG-ITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKA-----RFGRIVNITSVVGILGN-PGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAG-YITGQTLCVDGGLTP. 244
48 -85.2004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  30  3.MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSG-VYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEG-------ASIINISSVVTSITP-PASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSIGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDD-ARWMTGEHLVVSGGL... 249
49 -85.1003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  30  2...SLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAG-ITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKK-----RWGRIISIGSVVGSAGN-PGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAK-YITGQTLHVNGGMYM. 246
50 -85.0003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  24  6....STQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAG-ITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADR-----GWGRIVNISSVNGQKGQ-FGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEE-SGFSTGADFSLNGGLHM. 250
51 -84.8002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  27  9.RKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSS-RKQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKR-----GGGSVLIVSSVGAYHPF-PNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDAS-YITGETVVVGGGTAS. 258
52 -84.8001xkq_A mol:protein length:280 short-chain reductase family member (5D234)  ali model follow..  29  1.MPRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGR-SSERLEETRQIILKSGKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAG-AAIPDAFGTTGTDIYHKTLKLNLQAVIEMTKKVKPHLVA------SKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSL. 264
53 -84.6003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  27  10.RDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSS-RKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKR-----GGGSVVIVSSIAAFSPS-PGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDAS-YITGETVVVGGGTPS. 259
54 -84.5002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  23  28YYYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAG-ITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINN-----RYGRIINISSIVGLTGNV-GQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSG-YINGRVFVIDGGL... 273
55 -84.3004da9_A mol:protein length:280 Short-chain dehydrogenase/reductase  ali model follow..  23  17MMTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGASIVRDDFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLASD--ARASRSIINITSVSAVMTS-PERLDYCMSKAGLAAFSQGLALRLAETGIAVFEVRPGIIRSDMTAAVSGKYDGLIESGVPMRRWGEPEDIGNIVAGLAGGQFG-FATGSVIQADGGLSIG 272
56 -84.3004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  27  3MTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADL-LDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAG-VISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQ-----GRGRIINVASIAGKEGF-PNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKRHQLTLIPQGRAQTPEDMGRLALFFATMD---NVTGQAVNVDGGFTF. 259
57 -84.3001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  22  11...SFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAG-VSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQ----QKGSIVVTSSMSSQIINSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSD-HATYMTGGEYFIDGGQLI. 264
58 -84.2004e3z_A mol:protein length:272 Putative oxidoreductase protein  ali model follow..  28  14FQSMSDTPVVLVTGGSRGIGAAVCRLAARQGWRVGVNYAANREAADAVVAAITESGGEAVAIPGDVGNAADIAAMFSAVDRQFGRLDGLVNNAGIVDYPQRVDEMSVERIERMLRVNVTGSILCAAEAVRRMSRLYSGQG--GAIVNVSSMAAILGSATQYVDYAASKAAIDTFTIGLAREVAAEGIRVNAVRPGIIETDLHASGGLDRAREMAPSVPMQRAGMPEEVADAILYLLSPSAS-YVTGSILNVSGGR... 266
59 -84.2004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  23  15FQGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAG-ITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADR-----GWGRIVNISSVNGQKGQ-FGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEE-SGFSTGADFSLNGGLHM. 263
60 -84.2003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  16  2.......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDEL-------EAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKR-----KSGHIIFITSAAPFGPWK-ELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASG-SCDYLTGQVFWLAGGFPM. 245
61 -84.2004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  28  2MMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAA----AEIGPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAA-LFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQ----GRGGKIINMASQAGRRGE-ALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAE-SDYIVSQTYNVDGGNWM. 258
62 -84.2004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  29  15QSMSLQGKVALVTGASRGIGQAIALELGRLGAVV-IGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAG-ITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKA-----RWGRIINIGSVVGAMGN-AGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAA-YVTGATVPVNGGMYM. 262
63 -84.1003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  30  16MDKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAG-ITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKA-----RGGRIVNITSVVGSAGN-PGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAG-YITGTTLHVNGGMFM. 263
64 -84.1005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  28  2.MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDI-DGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKA------AKGNVVHLCSVAGFVSG-GSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMAS-YITGTILPVDGGFLA. 250
65 -84.1004iqg_C mol:protein length:271 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  13YFQSMLSKVVLITGGSRGIGAASALLAARQGYAVAVNYASNSAAADEVVRQIREAGGQALAVQADVAKEREVLAMFETVDAQLGRLSALVNNAGVVDQTTRVDGITLERLQRMFEINVFGSFLCAREAVKRMSTRYGGSG--GSIVNVSSAAARLGSPGQYVDYAAAKGAIDTFTLGLAKEVATEGIRVNAVRPGIIETDIHASGGLNRARDVAPQVPMQRAGTAREVAEAIVWLLGDQAS-YTTGALLDVTGGR... 265
66 -84.0001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  16  2.......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDEL-------EAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKR-----KSGHIIFITSATPFGPWK-ELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASG-SCDYLTGQVFWLAGGFPM. 245
67 -83.8004qec_A mol:protein length:248 ElxO  ali model follow..  23  2......KKNVLITGGFKGIGKQVALEFLKNDYHVCITS-RYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKV-----SCGAIVNISSITGLSGF-PYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNN-FITGHVLSIDGGYLS. 247
68 -83.8004jig_A mol:protein length:261 Dehydrogenase  ali model follow..  31  3MTASSDRKAVLITGASRGIGRATAVLAAERGWDVGINYARDAAAAELTAQAVRDAGGRACIVAGDVANEADVVAMFDTVAAAFGRLDALVNNAGIVAPSMPLADMPVDRLRRMFDTNVLGAYLCAREAARRLSTDRGGRG--GAIVNVSSIASRLGSPNEYVDYAGSKGAVDSLTIGLAKELGPHGVRVNAVRPGLIETDIHASGGQPGRARLGAQTPLGRAGEAQEVAEAIVWLLGDTAS-YTTGALLDVGGGR... 255
69 -83.7004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  25  2...AMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAG-ITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVER-----GWGRIVNISSVNGSKGS-VGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILDKILPQIPAGRLGKPEEVAALVAYLCSEE-AGFVTGSNIAINGGQHM. 248
70 -83.6003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  27  2..ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAA----AASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNAS-IVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAA----GKAGRVISIASNTFFAGT-PNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDAR-WITGQTLNVDAGMVR. 246
71 -83.4001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  26  2...RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEA-------GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAG-ITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREK-----NPGSIVLTASRVYL--GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESS-FITGQVLFVDGGRTI. 240
72 -83.3004one_A mol:protein length:262 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  24  1MAMSRQRPVALVTGGRRGIGLGIARALAAKGFDLAITDRES---DEAVIHELRGLGGKVAFFKSDLAAVKTHEATVFAVLDAFGGIDCLVNNAGGAVERGDFLALKPENFDTIMDVNLRGTVFFTQAVVKAMLAADEVR-FPRSIVTISSVSSVMTS-PERLDYCISKAGLTAFVQGLALRLAEARIGVFEVRPGIIRTDMTAKVAARYDALIEGGVPMKRWGEASDVGAIVAGLAGGDFI-FATGSAIHADGGLSIA 254
73 -83.2003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  28  23...DLSGKRALITGASTGIGKKVALAYAEAGAQVAVAAR-HSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAG-IVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQ----GLGGTIITTASMSGHIINIP-VSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPL-ADYHALWEPKIPLGRMGRPEELTGLYLYLASA-ASSYMTGSDIVIDGGYTCP 270
74 -83.1001spx_A mol:protein length:278 short-chain reductase family member (5L265)  ali model follow..  30  1.MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGR-HAERLEETRQQILAAGQNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGAASQSKTGTAQSIESYDATLNLNLRSVIALTKKAVPHLSSTK------GEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFGSAMGYSTMATMKECVPAGVMGQPQDIAEVIAFLADRKTSSYIIGHQLVVDGGSSL. 264
75 -83.1001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  25  2......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADY-NDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAG-VAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKE----GHGGKIINACSQAGHVGN-PELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEEFAKRITLGRLSEPEDVAACVSYLASPD-SDYMTGQSLLIDGGMVF. 255

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.