current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MAMRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFSDHGQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQGGGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNIPDDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGGYTAQLast
1 -106.0004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model  100  1MAMRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFSDHGQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQGGGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNIPDDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGGYTAQ 248
2 -100.0004ure_A mol:protein length:248 CYCLOHEXANOL DEHYDROGENASE  ali model follow..  42  1..MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGETPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNVPLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGGYLAR 248
3 -98.7004gh5_A mol:protein length:269 Short-chain dehydrogenase/reductase SDR  ali model follow..  38  9MSNRLKNEVIAITGGGAGIGLAIASAALREGAKVALIDLDQGAERSAAMLSTGGAVAKGFGADVTKAADITAAITSAEQTIGSLTGLVNNAGIAGFGSVHDADAAAWDRIMAVNVTGTFLASKAALAGMLERHKGTIVNFGSVAGLVGIPTMAAYCAAKGAIVNLTRQMAADYSGRGVRVNAVCPGTVTSTGMGQQSPEVQARRLAKYPIGRFGTPEDIAEAVIFLLSDQAAFVTGAAFAVDGGMTA. 262
4 -95.9002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  40  1.MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEAI-----GGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTAS 248
5 -95.7002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  37  2......SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETETARTHWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTA. 249
6 -95.4004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  37  15QSMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAV--RVANEIGSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSI. 265
7 -95.3001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  32  1MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNEALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG.... 262
8 -95.2004fn4_A mol:protein length:254 Short chain dehydrogenase  ali model follow..  37  2.YQSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLDRLNQIVQELRGMGKEVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVNGDAVVVDGGLTV. 253
9 -94.9001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  39  7PTTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGEASKAAVLETAAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAA 266
10 -94.3002zk7_A mol:protein length:257 Glucose 1-dehydrogenase related protein  ali model follow..  37  3MFSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPG----------EAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYA-PLLRCNAVCPATIDTPLVRKAIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR 250
11 -93.5003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  32  18.HPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAA--ATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTALGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIA. 268
12 -93.1003tzq_B mol:protein length:271 Short-chain type dehydrogenase/reductase  ali model follow..  35  5MTAELENKVAIITGACGGIGLETSRVLARAGARVVLADLPETDLA--GAAASVGRGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHSDDMLVTQMTVDVWDDTFTVNARGTMLMCKYAIPRLISAGGGAIVNISSATAHAAYDMSTAYACTKAAIETLTRYVATQYGRHGVRCNAIAPGLVRTPRLEVLPQPIVDIFATHHLAGRIGEPHEIAELVCFLASDRAAFITGQVIAADSGLLAH 253
13 -93.1005f1p_A mol:protein length:265 PtmO8  ali model follow..  39  4.VGRLEGKIAIVTGAASGIGAVTAERLAAEGARVALADLDVGVQTLAEKIRGAGTHAIGIEVDLADPASVRAMVAAAVEEFGGLDILHNNAAATADVPVADADPEVWDRTMRVNLSGAMVATQAALPHLIARGGGCVINTSSAAGLSGDLSHPAYAASKAALISLTRSVATQAGRSGVRCNAIAPGLIITRPER---EAAYRVMLPHHLTTRLGRPEDVASAVVFLASDEASFITGQTLVVDGGLLAH 254
14 -93.0003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  40  2VMSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNNALAELTDEIAGGGGEAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGALGAGEISSLSVEGWRETLDTNLTSAFLAAKYQVPAIAALGGGSLTFTSSFVGTAGFAGVAPYAASKAGLIGLVQALAVELGARGIRVNALLPGGTDTPANFANAPETRGFVEGLHALKRIARPEEIAEAALYLASDGASFVTGAALLADGGASV. 255
15 -92.6005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  33  1.MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNNLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFAL. 251
16 -92.2004qec_A mol:protein length:248 ElxO  ali model follow..  33  2......KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ 248
17 -92.1002dtd_A mol:protein length:264 Glucose 1-dehydrogenase related protein  ali model follow..  37  3.FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPG----------EAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYA-PLLRCNAVCPATIDTPLVRKAIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIR 249
18 -92.1004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  37  1..MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEAVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL. 246
19 -91.8003vtz_A mol:protein length:269 Glucose 1-dehydrogenase  ali model follow..  40  3.MEEFTDKVAIVTGGSSGIGLAVVDALVRYGAKVVSVSLDEKSDVNV---------SDHFKIDVTNEEEVKEAVEKTTKKYGRIDILVNNAGIEQYSPLHLTPTEIWRRIIDVNVNGSYLMAKYTIPVMLAIGHGSIINIASVQSYAATKNAAAYVTSKHALLGLTRSVAIDYA-PKIRCNAVCPGTIMTPMVIKAVERKIEEWGRQHPMGRIGRPEEVAEVVAFLASDRSSFITGACLTVDGGLLSK 250
20 -91.3004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  43  1MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNE---AAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM. 244
21 -90.4003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  36  17.MMNQPSPVALITGAGSGIGRATALALAADGVTVGALGRTTEVEEVADEIVGAGGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGINGVAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRGGGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEETAIPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGGQGL. 275
22 -90.2001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  31  6.NLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINDAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE 253
23 -89.9003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  17.MQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG----------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV. 259
24 -89.7004wec_A mol:protein length:278 Short chain dehydrogenase  ali model follow..  42  18LTQRLAGKVAVITGGASGIGLATGRRLRAEGATVVVGDIDPTGKAAADEL-----EGLFVPVDVSEQEAVDNLFDTAASTFGRVDIAFNNAGISPDDLIENTDLPAWQRVQDINLKSVYLSCRAALRHMVPAGKGSIINTASFVAVMGSASQISYTASKGGVLAMSRELGVQYARQGIRVNALCPGPVNTPLLQELDPERAARRLVHIPLGRFAEPEELAAAVAFLASDDASFITGSTFLVDGGISS. 266
25 -89.6005jc8_A mol:protein length:276 Putative short-chain dehydrogenase/reductase  ali model follow..  36  8...RLQGKVALVTGAGCGNGRAIAVRFAEEGAHVIAVDRDASMDATLELVRAAGGSVTPCLCDVTDSASVERLVADSVARCGRVDILVNNVGAPSPGGPVALDEAQWAMQLELNLTTAFLMCKYVLPVMEQQGGGAIVNIASTSGIRWTAAQVGYAAAKAGMIQMGRVVAVEYAAKNVRVNSVVPGLLHTPMVDTKVELLLRKRQARIPMPFMGDGRDTANAALFLASDEARFVTGTEIVVDGGMSAR 268
26 -89.5003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  32  4.SMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERV--AGEIGDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGKPQNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGAKVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSI. 256
27 -89.4004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  34  9RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPR----LAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSAM 261
28 -89.3004gkb_A mol:protein length:258 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  33  1MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVN-DGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHL-KATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWPEAKLAEIAAKVPLGRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTH. 252
29 -89.1003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  31  7.PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE 254
30 -89.0001yde_A mol:protein length:270 Retinal dehydrogenase/reductase 3  ali model follow..  34  3TGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGR---ALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYL-RKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELPRASIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGGAEL. 251
31 -88.7004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  34  14.MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY... 260
32 -88.2002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  36  2....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM. 246
33 -88.0005HS6 Entity 1(prereleased)  ali follow..  34  5TGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGR---ALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYL-RKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELPRATIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGGAEL. 253
34 -88.0004rf2_A mol:protein length:272 NADPH dependent R-specific alcohol dehydrogen  ali model follow..  37  13MTDRLKGKVAIVTGGTLGIGLAIADKFVEEGAKVVITGRHADVGEKAAKSIGGTDVIRFVQHDASDEAGWTKLFDTTEEAFGPVTTVVNNAGIAVSKSVEDTTTEEWRKLLSVNLDGVFFGTRLGIQRMKNKGGASIINMSSIEGFVGDPTLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDLGAEEMMSQRTKTPMGHIGEPNDIAWICVYLASDESKFATGAEFVVDGGYTAQ 264
35 -88.0003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  38  3MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVIYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK. 254
36 -88.0002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  34  1..MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM. 247
37 -87.9001nxq_A mol:protein length:251 R-alcohol dehydrogenase  ali model follow..  36  3...RLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGTPDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGGASIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDLGAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTAQ 251
38 -87.9001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  36  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ. 252
39 -87.8004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  39  1.MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGD--------LTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL. 240
40 -87.7001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  36  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL. 252
41 -87.7002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  33  1MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVP-APEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH 249
42 -87.6004yqz_A mol:protein length:257 Putative oxidoreductase  ali model follow..  32  17.MMKLKGKKALVIAAGQGIGRAIAEAFQREGAEVLGATLHPEKLQ---------GVVPAVRLDARDKEAVFRLI----QGLDRLDVLVNAQGVVPVGGLLEATDQDWEEAFLLNAKSVFWAMQAALPKMAAQGGGSVINIASVAAFKTVPGRFIYSATKAALVAMTKAAALEFAPKGVRVNAICPGTVDTPSLRERGEEGLRAFAERQLLKRLGRPEEIAALAVYLASDEGAFATGSAFVVDGGMSL. 251
43 -87.5003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  35  4.SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTAAWLY---SNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQIIR 252
44 -87.5004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  28  3MGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDREGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWG. 259
45 -87.5004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  38  1..MSTDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEEGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKYGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVV. 255
46 -87.3003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  2....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM. 246
47 -87.1004e4y_A mol:protein length:244 Short chain dehydrogenase family protein  ali model follow..  29  1...SNAMANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQ--------SFSAENLKFIKADLTKQQDITNVLDII--KNVSFDGIFLNAGILIKGSIFDIDIESIKKVLDLNVWSSIYFIKGLENNL--KVGASIVFNGSDQCFIAKPNSFAYTLSKGAIAQMTKSLALDLAKYQIRVNTVCPGTVDTDLYRNLFDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDKSKFMTGGLIPIDGGYTAQ 244
48 -87.1004jro_A mol:protein length:271 FabG protein  ali model follow..  37  18.AMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM. 265
49 -87.0004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  32  3MTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKRHQLTLIPQGRAQTPEDMGRLALFFATMD--NVTGQAVNVDGGFTFH 260
50 -86.7005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  30  2.MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPAL-KAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLA. 250
51 -86.7001hdc_A mol:protein length:254 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  36  2...DLSGKTVIITGGARGLGAEAARQAVAAGARVVLADVDEEGAATAREL---GDAARYQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAETGIRQGEGNYPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGGWTT. 244
52 -86.5003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  31  5MQLSFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKVQELEALGANGGAIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGSENGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGGGGSFVGISSIAASNTHRWFGAYGVTKSAVDHLMQLAADELGASWVRVNSIRPGLIRTDLVAAISAELSSDYAMCTPLPRQGEVEDVANMAMFLLSDAASFVTGQVINVDGGQMLR 259
53 -86.5004npc_A mol:protein length:265 Sorbitol dehydrogenase  ali model follow..  36  13.NFPLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISA--DIAKAKAEELGENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGGGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGKYGICVNTLSPTIVLTELGKKAAGEKGEAAKKRIPAGRFAYPEEIAAAAVFLASAGADMITGADLLIDGGYTI. 258
54 -86.4001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  40  1..MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAE----AVGAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI. 240
55 -86.4002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  39  1.MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREE--RLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVL--EEGGSLVLTGSVAGL-GAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI. 241
56 -86.2003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  31  5.MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVASTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL. 253
57 -86.2004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  34  18.AMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWIRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM. 265
58 -86.1001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  34  1......SPVVVVTGASRGIGKAIALSLGKAGCKVLVARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI. 244
59 -85.7003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  35  20....LKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.. 266
60 -85.7003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  35  1.TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAK--AAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH 247
61 -85.5004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  34  5LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM. 261
62 -85.4003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  36  8.KLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICSEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKQGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTV. 259
63 -85.4003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  31  1MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM. 249
64 -85.4003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  35  7.IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAV--VAGLENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQERTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD 263
65 -85.2003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  28  29VMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVASPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGRGRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVL. 278
66 -85.2002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  35  1MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM. 257
67 -85.0004lvu_A mol:protein length:279 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  30  28...SLAGRAVLITGGATGIGASFVEHFARQGARVAFVDLDEQARALAARLADAAHEPVFVACDLTDIAALRGAIEAIRARIGPIAALVNNAANDVRHAIADVTPDSFDACIAVNLRHQFFAAQAVIDDMKRLGGGSIVNLGSISWMLKNAGYPVYASAKAAVQGLTRALARELGPFGIRVNTLVPGWVMTDKQRRLDDAGRAAIKAGQCIDAELLPGDLARMALFLAADDSRMITAQDVVVDGGWA.. 273
68 -85.0001nff_A mol:protein length:260 Putative oxidoreductase Rv2002  ali model follow..  37  1MSGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDIDEEGKAMAAEL---ADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPED-----IFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA. 240
69 -84.9003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  30  2....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVIARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL. 248
70 -84.7005jla_A mol:protein length:274 Putative short-chain dehydrogenase/reductase  ali model follow..  34  8...EFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRV--ARATGGKT--LVLDVGEDASVTAAANEVRARYGVADVLVNCAGVLQRTPPGELAQREWDVVSRIDLRGTYLCCAAFGAPMADRRRGSIVNIASVAGMRSGPL-HAYGPAKAGVISLTETLAGEWGPKGVRVNCVSPGFTQTPALERGHTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPVDAGYLI. 250
71 -84.7001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  32  1..MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARAT--AAEIGPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS 256
72 -84.5003woh_A mol:protein length:251 SiaM  ali model follow..  32  5GPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKRSGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK--RLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM. 251
73 -84.5002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  30  1MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM... 247
74 -84.4003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  31  1MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAATSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYKH 258
75 -84.4004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  35  2MMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQA--AAEIGPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGGGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNWMS 259

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.