current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSLLast
1 -111.0004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model  100  1MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL 246
2 -106.0004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  53  1MSTDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKYGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVV 255
3 -106.0002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  41  1MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM 247
4 -106.0002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  41  2..LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM 246
5 -105.0004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  51  4.RLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM 244
6 -105.0003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  42  2..SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM 246
7 -105.0004jro_A mol:protein length:271 FabG protein  ali model follow..  43  19MTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM 265
8 -104.0004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  38  17..VQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY.. 260
9 -103.0001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  39  1....SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYRSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI 244
10 -103.0004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  52  3.KLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLG---------DLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL 240
11 -103.0001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  41  1MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAVGAHP-----VVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI 240
12 -103.0004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  30  19MQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM 265
13 -103.0004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  43  8.RLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM 261
14 -103.0003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  1MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM 246
15 -102.0002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  43  4.RLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM 257
16 -102.0003woh_A mol:protein length:251 SiaM  ali model follow..  39  9..LSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKRSGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK--RLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM 251
17 -101.0004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  40  4QDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGGEG--RVLNSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQRAGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLM 247
18 -101.0002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  34  30YCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS. 274
19 -101.0004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  38  17MSLQGKVALVTGASRGIGQAIALELGRLGAVVIGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYM 262
20 -100.0003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  40  18KTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM 263
21 -100.0002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  36  3IKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGEAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM.. 247
22 -100.0003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  38  6FDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL---GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM 248
23 -99.3002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  37  2.....RKALITGASRGIGRAIALRLAEDGFALAIHYQNREKAEEVAEEARRRGSPLVALGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTP 244
24 -99.1003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  38  3MVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM 249
25 -98.9003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  35  17FKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL---GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLNEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM 259
26 -98.9005cdy_A mol:protein length:244 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  41  1MSFEGKIALVTGASRGIGRAIAELLVERGACVIGTATSEKGAEAISAYL---GENGKGLMLNVVDPTSIDTVLATIRAEFGEVDILVNNAGITRDNLLMRMKDDEWQDIIDTNLTSVFRLSKAVMRAMMKKRFGRIITIGSVVGTMGNAGQVNYAAAKAGVIGFSKSLAREVASRGITVNVVAPGFIETDMTRTLTDDQRAGILAQVPANRLGDAKEIASAVAFLASDEASYISGETLHVNGGMYM 243
27 -98.9001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  38  1MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM 243
28 -98.8003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  34  4IDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNAL---KDNYTIEVCNLANKEECSNLIS----KTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM 242
29 -98.7004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  38  4LGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATDGG----------NTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYERKAGSIVAISSISGERGNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPVASYVTGEVLRVNGAH.. 238
30 -98.7004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  42  3.ALTAQVALVTGASRGIGKATALALAATGMKVVVNYQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNA---EPILQFIPLARYGQPEEVAGTIRFLATDPAAYITGQTFNVDGGMVM 246
31 -98.6003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  41  8MNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL---GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM 250
32 -98.5003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  38  4SGSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM 250
33 -98.1004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  35  17PSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVAGKTYSIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYM 266
34 -97.7003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  33  5MRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTA---AWLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII 251
35 -97.5004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  39  1MAMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGWGRIVNISSVNGSKGSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILDTILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQHM 248
36 -97.4003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  34  8FHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQ 253
37 -97.4004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  42  18LPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYSSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAA---EKLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVM 262
38 -97.4003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  33  6FDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL 253
39 -97.2004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  38  17GAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM 263
40 -97.2005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  31  3.RLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFAL 251
41 -97.0001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  34  7LRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ 252
42 -96.4003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  35  31FDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAASPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGRGRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVL 278
43 -96.4004cql_B mol:protein length:244 CARBONYL REDUCTASE FAMILY MEMBER 4  ali model follow..  32  1..MMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDL---GGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKE---EHLKKNIPLGRFGETIEVAHAVVFLLE--SPYITGHVLVVDGGLQL 236
44 -96.3004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  31  16SNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKE-AMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML. 261
45 -95.9003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  33  2ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI---GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVR 246
46 -95.9003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  37  15SMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSRNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM 262
47 -95.7004qec_A mol:protein length:248 ElxO  ali model follow..  29  2....KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLS 247
48 -95.6004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  36  5APLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKRHQLTLIPQGRAQTPEDMGRLALFFATM--DNVTGQAVNVDGGFTF 259
49 -95.4004kms_A mol:protein length:249 Acetoacetyl-CoA reductase  ali model follow..  36  2..AMSEIAIVTGGTRGIGKATALELKNKGLTVVANFFSNYDAAKEMEE----KYGIKTKCWNVADFEECRQAVKEIEEEFKKVSILVNNAGITKDKMLHRMSHQDWNDVINVNLNSCFNMSSSVMEQMRNQDYGRIVNISSINAQAGQVGQTNYSAAKAGIIGFTKALARETASKNITVNCIAPGYIATEMVGAVPEDVLAKIINSIPKKRLGQPEEIARAVAFLVDENAGFITGETISINGGHNM 242
50 -94.7001uzl_A mol:protein length:247 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE  ali model follow..  37  11PPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKG-----------LFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM 245
51 -94.7003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  23  3LGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV 253
52 -94.6001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  35  16ATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN 274
53 -94.2002nm0_A mol:protein length:253 Probable 3-oxacyl-(Acyl-carrier-protein) redu  ali model follow..  37  11RSHMSRSVLVTGGNRGIGLAIARAFADAGDKVAITYRSGEPPEG-----------FLAVKCDITDTEQVEQAYKEIEETHGPVEVLIANAGVTKDQLLMRMSEEDFTSVVETNLTGTFRVVKRANRAMLRAKKGRVVLISSVVGLLGSAGQANYAASKAGLVGFARSLARELGSRNITFNVVAPGFVDTDMTKVLTDEQRANIVSQVPLGRYARPEEIAATVRFLASDDASYITGAVIPVDGGLGM 245
54 -93.8003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  28  2..EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYASKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL 248
55 -93.6001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  33  3KKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG... 262
56 -93.6002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  34  3.RLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREER---LLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVL--EEGGSLVLTGSVAGL-GAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI 241
57 -93.6003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  36  8FDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQERTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRM 262
58 -93.4002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  33  3QRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVP--APEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVR 248
59 -93.4004yxf_A mol:protein length:257 MupS  ali model follow..  29  17PSAVKGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSE----RADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDMVKDLSPQTLSRIERRTPLGRLGTQQEVADLILYLVDR-GTFVTGQNIAVDGGFTC 257
60 -93.4005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  32  4.LLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVP-ALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLA 250
61 -93.3003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  37  20..LKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA. 266
62 -93.2002ntn_A mol:protein length:267 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  38  25PPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKG-----------LFGVEVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIASVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM 259
63 -92.6003sju_A mol:protein length:279 Keto reductase  ali model follow..  35  14HMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRAMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGN 272
64 -92.4001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  30  1MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWM 255
65 -92.3002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  33  3.LFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE------AIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTA 247
66 -92.1004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  37  3MRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFSDH-GQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQGGGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNIPDDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGGYTA 247
67 -92.0001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  34  4.DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL 252
68 -91.8003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  18QGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG-----------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV 259
69 -91.7001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  33  4.DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ 252
70 -91.4003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  32  6.DLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK 254
71 -91.2001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  32  10ISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLKQQKGSIVVTSSMSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI 264
72 -91.1004one_A mol:protein length:262 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  29  3MSRQRPVALVTGGRRGIGLGIARALAAKGFDLAITDRESD--EAVIHELRGLGGKVAFFKSDLAAVKTHEATVFAVLDAFGGIDCLVNNAGMVERGDFLALKPENFDTIMDVNLRGTVFFTQAVVKAMLAADEVRIVTISSVSSVMTSPERLDYCISKAGLTAFVQGLALRLAEARIGVFEVRPGIIRTDMTAKVAARYDALIEGLVPMKRWGEASDVGAIVAGLAGGDFIFATGSAIHADGGLSI 253
73 -91.0002cf2_E mol:protein length:226 FATTY ACID SYNTHASE, KR DOMAIN  ali model follow..  38  1MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIG---------GQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETSDDQ------RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM.. 226
74 -90.7003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  34  4MSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVF 261
75 -90.6004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  28  3PDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYK 257

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.