current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGDLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGANVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRLLast
1 -110.0004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model  100  1MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGDLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGANVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL 240
2 -104.0004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  47  2MSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKG--INVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM 244
3 -103.0004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  52  2..KLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQRLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKG--VRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL 246
4 -102.0002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  44  1..MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRN--ITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM 246
5 -101.0002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  44  2..QLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKG--IYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM 247
6 -101.0003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  46  2...SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRG--ITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM 246
7 -101.0004jro_A mol:protein length:271 FabG protein  ali model follow..  46  18AMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRG--INVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM 265
8 -100.0004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  35  14MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKN--IRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY.. 260
9 -99.6001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  39  2..RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLEAVGAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWG--IRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI 240
10 -99.4004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  33  18AMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRN--IRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM 265
11 -98.9001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  42  1.....SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRN--INVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI 244
12 -98.8003woh_A mol:protein length:251 SiaM  ali model follow..  41  6PGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKRSGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERN--VRCNAVAPGLIATDMTQDLVDDSK--RLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM 251
13 -98.7004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  44  2..STDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKYGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYG--ITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVV 255
14 -98.3004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  44  6...LEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLAT-DGGNTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYERKAGSIVAISSISGERGNVGQTNYSATKAGVIGMMKSLAREGARYG--VRANAVAPGFIDTEMTLAIREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPVASYVTGEVLRVNGAH.. 238
15 -98.0004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  40  6QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHG--IRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM 261
16 -97.9003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  42  5MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRN--VTVNCIAPGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM 248
17 -97.9002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  42  5...LQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRN--VLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM.. 247
18 -97.5003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  38  3...LNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRN--ITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM 246
19 -97.2002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  40  2QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHG--IRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM 257
20 -97.1003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  39  16MFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREAADLGKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRN--ITVNCIAPGFIKSAMTDKLNEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM 259
21 -96.7004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  45  3TQDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISGEGRVLNSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQRAGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRG--ITVNCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLM 247
22 -96.6003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  46  7FMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRG--VTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM 250
23 -96.5005cdy_A mol:protein length:244 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  44  3...FEGKIALVTGASRGIGRAIAELLVERGACVIGTATSESAYLGENGKGLMLNVVDPTSIDTVLATIRAEFGEVDILVNNAGITRDNLLMRMKDDEWQDIIDTNLTSVFRLSKAVMRAMMKKRFGRIITIGSVVGTMGNAGQVNYAAAKAGVIGFSKSLAREVASRG--ITVNVVAPGFIETDMTRTLTDDQRAGILAQVPANRLGDAKEIASAVAFLASDEASYISGETLHVNGGMYM 243
24 -96.4001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  44  3...FEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSESDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRG--ITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM 243
25 -96.3004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  42  16SMSLQGKVALVTGASRGIGQAIALELGRLGAVVIGTATSALKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRA--ITVNAVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYM 262
26 -96.3003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  45  17DKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRG--ITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM 263
27 -96.3002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  39  2......RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKASPLVAVLGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRG--ITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTP 244
28 -96.2002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  36  29YYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRN--ITVNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS. 274
29 -96.0004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  45  1MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRG--VTVNAVAPGFIATDMTENLNA---EPILQFIPLARYGQPEEVAGTIRFLATDPAAYITGQTFNVDGGMVM 246
30 -95.8003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  40  3MIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEGNALKDNYTIEVCNLANKEECSNLIS----KTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRG--ITVNAVAPGFIKSDMTDKLNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM 242
31 -95.5003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  41  4..VMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKG--VTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM 249
32 -95.0004kms_A mol:protein length:249 Acetoacetyl-CoA reductase  ali model follow..  40  1..MAMSEIAIVTGGTRGIGKATALELKNKGLTVVANFFSNYDAAKYGIKTKCWNVADFEECRQAVKEIEEEFKKVSILVNNAGITKDKMLHRMSHQDWNDVINVNLNSCFNMSSSVMEQMRNQDYGRIVNISSINAQAGQVGQTNYSAAKAGIIGFTKALARETASKN--ITVNCIAPGYIATEMVGAVPEDVLAKIINSIPKKRLGQPEEIARAVAFLVDENAGFITGETISINGGHNM 242
33 -95.0003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  42  5..GSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKG--VTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM 250
34 -94.4001uzl_A mol:protein length:247 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE  ali model follow..  38  13...FVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKG--LFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKAN--VTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM 245
35 -94.1003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  5MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHK--ITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL 253
36 -94.1002nm0_A mol:protein length:253 Probable 3-oxacyl-(Acyl-carrier-protein) redu  ali model follow..  35  10PRSHMSRSVLVTGGNRGIGLAIARAFADAGDKVAITYRSGEPPEG--FLAVKCDITDTEQVEQAYKEIEETHGPVEVLIANAGVTKDQLLMRMSEEDFTSVVETNLTGTFRVVKRANRAMLRAKKGRVVLISSVVGLLGSAGQANYAASKAGLVGFARSLARELGSRN--ITFNVVAPGFVDTDMTKVLTDEQRANIVSQVPLGRYARPEEIAATVRFLASDDASYITGAVIPVDGGLGM 245
37 -94.1004cql_B mol:protein length:244 CARBONYL REDUCTASE FAMILY MEMBER 4  ali model follow..  28  1...MMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKK--IRVNVVAPGFVHTDMTKDLKE---EHLKKNIPLGRFGETIEVAHAVVFLLE--SPYITGHVLVVDGGLQL 236
38 -93.9004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  42  18..AMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKG--VTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM 263
39 -93.7004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  42  17ALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRG--ITVNAVAPGFIATDMTSELAA---EKLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVM 262
40 -93.5004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  40  3...MTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGWGRIVNISSVNGSKGSVGQTNYAAAKAGMHGFTKSLALEIARKG--VTVNTVSPGYLATKMVTAIPQDILDTILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQHM 248
41 -93.5003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  36  30MFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGRGRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRG--VTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVL 278
42 -93.0004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  37  16RPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVALGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVAGKTYSIVACHYAATKSAIIGFTKHLAAELGPYS--IRVNAMAPGRIATPMVAGVAPEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYM 266
43 -92.9002ntn_A mol:protein length:267 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  38  26..PFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKG--LFGVEVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIASVSGLWGIGNQANYAASKAGVIGMARSIARELSKAN--VTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM 259
44 -92.8003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  37  2.ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYN--ITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVR 246
45 -92.6003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  39  16..MQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSEHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRG--ITVNTVSPGYLATAMVEAVPQDVLEKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM 262
46 -92.4004yxf_A mol:protein length:257 MupS  ali model follow..  32  16APSAVKGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVRADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRG--IRVNSVSPGYFSSDMVKDLSPQTLSRIERRTPLGRLGTQQEVADLILYLVDR-GTFVTGQNIAVDGGFTC 257
47 -91.9002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  34  1MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVL--EEGGSLVLTGSVAGL-GAFGLAHYAAGKLGVVGLARTLALELARKG--VRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI 241
48 -91.9004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  34  15QSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRK--ITVNCIAPGLIDTGMIEMEESAL-KEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML. 261
49 -91.3005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  34  1MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAAIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKN--IRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFAL 251
50 -90.9002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  36  1MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGAEAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLR--IRVNAVAPGAIATEAVLEAPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTA 247
51 -90.9003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  32  17MQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAV--AGIAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQG--IRINAVCPNEVNTPMLRTGPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV 259
52 -90.4003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  33  4SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTA---AWLYSNYYGLAKVGINGLTQQLSRELGGRN--IRINAIAPGPIDTEANTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII 251
53 -90.4003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  37  7PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMG--IRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQ 253
54 -90.0002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  36  3.QRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDG--ITVNAIAPSLVRTATTEASALSAMFDVLPNMAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVR 248
55 -90.0004qec_A mol:protein length:248 ElxO  ali model follow..  32  2.....KKNVLITGGFKGIGKQVALEFLKNDYHVCITSPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKG--IKINAVAPGIIKTETLQKEGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLS 247
56 -89.9001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  33  15MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTG--ITVNAVCPGFVETPMAASVTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN 274
57 -89.8004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  35  4TAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLEVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDG--VTVNAICPGIVRTYMWDRLSDEWKRHQLTLIPQGRAQTPEDMGRLALFFATM--DNVTGQAVNVDGGFTF 259
58 -89.7003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  30  5...RFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYG--ITANMVCPGDIIGEMKEATIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV 253
59 -89.3001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  36  8..RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKN--IRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ 252
60 -89.3003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  35  7IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVVAGLENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKN--IRVNCVCPGFVKTAMQERTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRM 262
61 -89.1005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  35  2MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVP-ALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHG--IRVNAVAPGIMMSEMAVAQRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLA 250
62 -88.7003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  28  1..MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYAREIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQ--IIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL 248
63 -88.4003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  34  18.GLLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGEGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFG--VRINAVSPSIARHKFLEKTSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA. 266
64 -88.0002fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena  ali model follow..  33  5...FSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQA-FTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSG--VRCNVVSPGSTDTDMQRTLWRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTL 248
65 -87.8004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  39  2AMRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFSDRAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQGGGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQN--IRVNAVCPGYIDTPLLKNIPDDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGGYTA 247
66 -87.5004o6v_A mol:protein length:242 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  30  1MAMTIQKVAIITAGGSGMGAASARRLAQDGFAVAILSSSGKGEAELGGIGVTGSNQSNDDLQKLVDQTLEKWGRIDVLVNSAGHGPRAPILEITDEDWHKGMDTYFLNAVRPARLVVPAMQKQKSGVIINISTAWAFEPSAMFPTSAVFRAGLASFTKIFADTYAAEN--IRMNNVLPGWIDSLPTT-------EERRESVPMQRYGKSEEIAATVSFLASDGAAYITGQNLRVDGGLTR 234
67 -87.5003sju_A mol:protein length:279 Keto reductase  ali model follow..  34  15..MSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRAMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTG--ITVNAVCPGYVETPMAERVEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGN 272
68 -87.0001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  23  2......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYN--IPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM 245
69 -87.0003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  35  4YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKG--IRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK 254
70 -87.0002cf2_E mol:protein length:226 FATTY ACID SYNTHASE, KR DOMAIN  ali model follow..  43  3...FEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSESDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIG---------GQANYAAAKAGLIGFSKSLAREVASRG--ITVNVVAPGFIETSDD------QRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM.. 226
71 -87.0003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  23  2......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYN--IPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM 245
72 -86.8001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  38  3.KDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKG--IRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL 252
73 -86.8001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  32  12...FVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLKQQKGSIVVTSSMSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAG--IRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI 264
74 -86.7001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  38  3.KDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKG--IRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ 252
75 -86.6001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  34  2..RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLAAEIGPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHG--INVNAIAPGVVDGEHWDGVDAEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWM 255

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.