current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4mzv_A mol:protein length:248 Epithelial cell adhesion molecule, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst EEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMQGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCQGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQQSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKLast
1 -122.0004mzv_A mol:protein length:248 Epithelial cell adhesion molecule  ali model  100  1EEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMQGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCQGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQQSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK 242
2 -25.9001rmj_A mol:protein length:107 Insulin-like growth factor binding protein 6  ali model follow..  25  36............................................................QTEVYRGAQTLYVPNCDHRGFYRKRQCRSSGPCWCVDRMGKSLPGSPDGNG................................................................................................................................... 91
3 -25.2002h7t_A mol:protein length:107 Insulin-like growth factor-binding protein 2  ali model follow..  30  17.................................................LERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSGECWCVNPTGKLIQGAPTIRG................................................................................................................................... 84
4 -24.6002dsq_G mol:protein length:94 Insulin-like growth factor-binding protein 1  ali model follow..  22  12..............................................RIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCEEAGLCWCVYPNGKRIPGSPEI..................................................................................................................................... 80
5 -24.3001icf_I mol:protein length:65 PROTEIN (INVARIANT CHAIN)  ali model follow..  22  2......................................................TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYSIGYCWCVFPNGTEVPNTRSRGH................................................................................................................................... 59
6 -23.3002dsr_G mol:protein length:82 Insulin-like growth factor-binding protein 4  ali model follow..  24  4..............................................QSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPAGKCWCVDRTGVKLPGGLEPKG................................................................................................................................... 74
7 -17.4002v53_A mol:protein length:230 SPARC  ali model follow..  4ANPCQNHHCKHGKVCELDENNTPMCVC--------------------------------QDPTSCPAPIGEFEKVCSNDNKTFDSSCHFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPME---TTRFFETCDLDNDYIALDEW. 213
8 -13.8001bmo_A mol:protein length:233 BM-40  ali model follow..  2...CQNHHCKHGKVCDENNTPMCVCQ----------------------------------DPTSCPAPIGEFEKVCSNDNKTFDSSCHFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPME---TTRFFETCDLDNDYIALDEW. 216
9 -13.3001npe_B mol:protein length:164 Laminin gamma-1 chain  ali model follow..  24  35.ELCDDGGDPLGSNGPVRLCRPCQCNDNIDPNAVNCNRLTGECLKCIYNTAGFYCDRCKENPLAPNPADKCKACACNPYGTVQQQSCNPTGQCQCLPHVSGRDCGTCDP..................................................................................................................................... 151
10 -13.1001npe_A mol:protein length:267 nidogen  ali model follow..  11  7.........................................................................................................................................AQTGKIERLPLERNTMKKTEAKAFLHIPAKVIIGLAFDCVDKVVYWTDISEPSIGRAHGGEPTTIIRQDLGS----PEGIALDHLGRTIFWTDSQLDRIEVAKMD 109
11 -13.1002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  13  183..QCECRCRDQSRDCHGKGCGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNS-----------------IICSGLG-----DCV-CGQCLCHTS................................................................................................................................................ 261
12 -12.7003v64_C mol:protein length:349 agrin  ali model follow..  13  2.NECAEEGYCSQGCTNSEGAFQCWCE-----AGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFW-SDVTLDRILRANLNGSNVEEVVST--GLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGIADTHLFW----PNGLTIDYAGRRMYWVDAKHHVIERANLD 233
13 -12.4004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  13  147..RVVCSDNYYGDSCSRQPDGSPSCLPGWTGK---------YCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNEHKGCRHGTCTIPWQCACDEGWGGLFCDQAAA..................................................................................................................................... 261
14 -12.1003s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  264.NECASSNGHCSHLCVPVGGFVCGCP-----AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLS 505
15 -12.1004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  12  148..RVVCSDNYYGDSCSRQPDGSPSCLPGWTGK--YCDQ-----------------------------------PICLSGCHEQNGYCSKPDECNCRPGWQGPLCNEAA...................................................................................................................................... 230
16 -11.6003s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  263.NECASSNGHCSHLCVPVGGFVCGCP-----AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLS 504
17 -11.3001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  10  6.QTCANQCSVHAECRDYATGFCCRCVANYTGNGRQCVAEGSPQRVNGKVKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSYTAISTIPETGYSMFAVENGFSITGGEFTRQAEVTFLGHPGKLVLKQQFSGIDEHGHLTISTEASVHIEPYTELYHYSSSVITSSSTREYTVMEPDQDGAAPSHTH---IYQWRQTITFQECAHDDARPALPSTQQLSVDSVFVL-YNKEERILRYALSN.. 273
18 -10.8004a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  266.NECASSNGHCSHLCVPVGGFVCGCP-----AHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLS 507
19 -10.7004aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  17  406AGQCRCKLHVEGERCDVYGCKSCACNPLGTPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNE........................................................................................................................................ 525
20 -10.4003v65_B mol:protein length:386 Low-density lipoprotein receptor-related prot  ali model follow..  13  3EENCNNNGGCAQKCQMIRGAVQCTCHTGYRLTEDG---------------------------------------TCQDVN-----ECAEEGYC-CTNSEGAFQCW------------EAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVTLDRILRANLNGSNVEEVVSTGLES----PGGLAVDWVHDKLYWTDSGTSRIEVANLD 189
21 -10.4002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  19  5.DECESSPCINGVCKNSPGSFICECSSESTLDPTKCWQTVIDGRCINGATLKSQCCSSLGAAWGSPCTLCQVDPICGKG-RIKGTQCEDIDEC-CVNTRGSFKC.......................................................................................................................................... 131
22 -9.9502ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  14  164RRICECPDGFHGPHCEKATPGFCICPPGFYGV--NCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQEISKCPQPCRNGG-----KCIGKSKCKCSKGYQGDLCSKPV...................................................................................................................................... 278
23 -9.9404wnx_A mol:protein length:433 Netrin-4  ali model follow..  15  261HGRCMCKHNTAGSHCQHNECRTCKCNGHADTWEASGNRSGGVCNNCQHNTEGQHCQRCKPGFYRFSAPDACKACSCHPVGSASVTFCDPNGDCPCKPGVAGPHCDRCMV..................................................................................................................................... 407
24 -9.7904k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  16  215TGECICPPGFMGRTCEKA-GRTCKCSGQEGKSYVFCLPDPYGCSCATGWKGLQCNEAC---------HPGFYGPDCKLRCSNNGEMCDRFQGCLCSPGWQGLQCERE....................................................................................................................................... 321
25 -9.7003s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  12  264TNPCGIDNGGCSHLCPVKPFYQCACP-----TGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTA--QIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLG-WPNGLALDYDEGKIYWGDAKTDKIEVMNTD 501
26 -9.3102bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  17  3.RGCARWCPQDSSCVN---ATACRCNPGFSSFSEIITTPMETC--DDINECATLSKVSCGKFSDCWNTEGSYDCVCSPG---SENTCQDVDEC-CFNTVGS............................................................................................................................................. 118
27 -9.2505e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  11  181LPQCECRCRDQS-LCHGKGCGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNS-----------------IICSGLGDCVCGQCLFCGKCRCHPGFEGSACQ......................................................................................................................................... 313
28 -9.1801n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  13  11.HKCIDTNVPENAACYRDGTEEWRCLLGFKEVGGKCVPASITCEENNG--------------------------GCAPEA-----ECTMDDECKCTKE................................................................................................................................................ 82
29 -9.0404cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  18  219..DCRCQYGWQGLYCDKNEPWQCLCETNWGGQ--LCDKDLNYCGTHQP---------------------------CLNGGT-----CSNTGQCSCPEGYSGPNCEIVD...................................................................................................................................... 306
30 -9.0202m74_A mol:protein length:136 Fibrillin-1  ali model follow..  17  55PNMCTCPSGQIAPSCGSRSIQHCNCMNGGSCSDDHCL--------------------CQKGYIGTHCGQPVCESGCLNGG-----RCVAPNRCACTYGFTGPQCE......................................................................................................................................... 136
31 -9.0105c1z_A mol:protein length:405 E3 ubiquitin-protein ligase parkin  ali model follow..  17  274RPGCGAEPDQRKVTCEGGNGLGCECKEAYH-EGECSAVFEASGTTTQAYRVDERAAEQARWEAASKEKTTKPCPRCEKNGGCMHMKCPQPQWCWCGCEWNRVCMGDH....................................................................................................................................... 401

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;