current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4k0v_A mol:protein length:529 TEK tyrosine kinase variant, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .
# Score Template Links and tools%idFirst AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGGSASGLVPRLast
1 -120.0004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model  100  1AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGGSASGLVPR 529
2 -29.7004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  26  156............................................................................................................................................................................................CDDYYYGFGCNKFCRDDFFGHYACDQNGNKTCMEGWMGPECNRACQYGWQGLYCDK-CI-PHPGCVHGICN-EPWQCLCETNWGGQLCDKDLN------YCGTHQPCLNGGTCSNTGQCSCPEGYSGPNCEIV................................................................................................................................................................................................................ 305
3 -28.9002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  22  73............................................................................................................................................LSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGV-LKTPQNAIFFKTCQQAEGGCRNGGFCNE-RRICECPDGFHGPHCEKACPPGFYGVNCDKA-NCSTTCFNGGTCFY-PGKCICPPGLEGEQCEISCSKGYQGDLCSKPVGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIG......................................................................................................................................................................................................... 316
4 -28.0004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  28  150............................................................................................................................................................................................CSDNYYGDSCSRLCDDHFGHYECQP-DGSPSCLPGWTGKYCDQP--------ICLSGC-----HEQNGYCS-KPDECNCRPGWQGPLCNECIPH-----------KGCRHGTCTIPWQCACDEGWGGLFCDQAAA.............................................................................................................................................................................................................. 261
5 -26.1002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  26  15............................................................................................................................................................................................CDDYYYGFGCNKFCRDDFFGHYACDQNGNKTCMEGWMGPECNRACQYGWQGLYCDK-CI-PHPGCVHGICN-EPWQCLCETNWGGQLCDKDL------NYCGTHQPCLNGGTCSNTGPCSCPEGYSGPNCE.................................................................................................................................................................................................................. 162
6 -26.1004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  24  23..................................................................................................................................................................................................GRPCEPGCRTCLKHYQATFSEGPCTTWPGTFSLNIQAVCSDNYYGDSCSRLCKKRDDHFGHYECQP-DGSPSCLPGWTGKYCDQPI--------CLSGC-HEQNGYCSKPDECNCRPGWQGPLCNEAA............................................................................................................................................................................................................... 230
7 -26.1004aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  15  225....................TLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCY-GHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCE-------------------LCMDFYHDL---------RPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCD------------------NCQHNTMGRNCEQLCEPCTTDFSVGLIAGQCRCKLHVEGERCDV-CKEGFYDYGCKSACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQ-CLPQHWGDGCR-PCDCDLGGACSEDSGCSCLPHMIGRQCNE................................................................................................................................................................................................................. 525
8 -25.2004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  14  30...............GPPPCACRTFFRVCLKHYQASVSPEPPCTYGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSDLATENPERLISRLATQRHLTVGE---------WSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCG-------------ERGEKVCNPGWKGPYCTPICLPDEQHGFCDK-PGECKCRVGWQGRYCDENCQEGWGGLFCNQYCTHHKPCKNGATCTNTSYTCSCRPGYTGATCELGCPPGFYGKICEMTCACFNGGRCSDSPDCRCPVGYSGFNCEKKIDY--SSSPCSNGAKCVDLGDAYLCRCQ-AGFSGRHCDD---------------NVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPCHNGATCHQRGHGYVCECARSYGGPNCQFLLPELPPGPAVVDLTE...................................................................... 514
9 -21.6004wnx_A mol:protein length:433 Netrin-4  ali model follow..  22  232...........................................................................................................................................................................................SCFCNGHADQCLEGFRPIKAPGAFHVVHGRCMCKHNTAGSHCQH-CAPLYNDNECR-TCKCNGHADTEASGNRSGGVCNCQHNTEGQHCQR-CKPGFYRDAC-KACSCHPVGSCDPSNGCPCKPGVAGPHCDR-CMVGYWGGCRPCDCAGSCDPLTGDC....................................................................................................................................................................................... 433
10 -21.5003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  17  294..................................................................................................................................................................................................RGRCK--CNLHATVCVYDNSKLTCECEHNTTGPDCGK-CKKNYQGRPWSPACIPSISSIGTNVCDNELLHCQNGGTCHNNVRCL-CPAAYTGILCE-KLRCEEAGSCGSDSGGAPPHG......................................................................................................................................................................................................................... 419
11 -21.0005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  28  29............................................................................................................................................................................................CPPSFHGPTCRNECGQCRHGGTCHNEVGRCVCRATHTGPNCERPYVP------CS-----PSPCQNGGTCRPTGDVCACLPGFTGQNCEENID------DCPGN-NCKNGGACVDGVNCRCPPEWTGQYCTE................................................................................................................................................................................................................. 157
12 -20.9005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  28  26............................................................................................................................................................................................CPPSFHGPTCRNECGECRHGGTCHNEVGRCVCRATHTGPNCERPYVP------CS-----PSPCQNGGTCRPTGDVCACLPGFTGQNCEENID------DCPGN-NCKNGGACVDGVNCRCPPEWTGQYCTE................................................................................................................................................................................................................. 154
13 -20.8002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  23  25............................................................................................................................................................................................CCPGWKTLPGGNQCHSCGDGFCSRP--NMCTCPSGQIAPSCGSRSIQ-----------HCNIRCMNGGSC--SDDHCLCQKGYIGTHCGQPVCES----------GCLNGGRCVAPNRCACTYGFTGPQCE.................................................................................................................................................................................................................. 136
14 -20.7004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  22  1...................................................................................................................................................................................................DICDP--NPCENGGICLPGLASCECPDGFTDPNCSSVVEVASDEEEPTSAGPCPNPCHNGGTCEISEAVCKCPRGFNGIHCQHNIN------ECEVE-PCKNGGICTDLVACECPGEFMGRNCQYKG............................................................................................................................................................................................................... 135
15 -20.7001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  17  27..........................................................................................................................................................................................EDSDKTNEFWNKYDQCETCQNQGKCKDGLGTCTCLEGFEGKNCELFTRK----------LCSLDNGDCDQFCHEEQNSCSCARGYTLADNGKACIP--------GPYPCGKQTLERRKRSATSSSGEAPDSITWKPYDAADLDPTENPFDLLDFNQTQPERGDNN.................................................................................................................................................................................. 186
16 -20.4004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  11  67...........................................................................................................................................................................................EGPIGFRATLTQSNTYAWHPGGTWGTMTYAGEGPIGFKSQQADGGVYAVENQWGGS-----SAPWHNGGVWVNMTYAGEGPIGFKGNSVAGPWHPGLLGCRSGQYITSGDNGNTFHGSMGEGPIGFRAMALPQ................................................................................................................................................................................................................. 279
17 -20.1004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  26  3...................................................................................................................................................................................................DECALGANPCEHAGKCLNTLGECQCLQGYTGPRCEIDVNE------CI-----SNPCQNDATCLDQIGECICMPGYEGVYCEINTD------ECASS-PCLHNGRCVDKINCQCPKGFSGHLCQSG................................................................................................................................................................................................................ 117
18 -20.1002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  6...................................................................................................................................................................................................DECSLGANPCEHAGKCINTLGECQCLQGYTGPRCEIDVNE------CV-----SNPCQNDATCLDQIGECICMPGYEGVHCEVNTD------ECASS-PCLHNGRCLDKINCECPTGFTGHLCQVD................................................................................................................................................................................................................ 120
19 -19.9004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  13  14.........................................................................................................................................................................................QATWNPGGIGARDKQNVVALDDGGKTLKGTMNGEGPIGFRGTLSSAPWQPGVLGARDKQNIAVSIKSNDGGKTLTGTTTGEGPIGFKSEVTDAPWHSGVLGTRGKQDAKSNDGGKTLSGTMGEGPIGFRGTLTSYTVENQWGGSTAPWNPGGFWMIGARNGQNVVA.................................................................................................................................................................................. 236
20 -19.5004urt_A mol:protein length:420 NETRIN-1  ali model follow..  23  248....................................................................................................................................................................................................KCNGHAARCV---RDRDDSLVCDCRHNTAGPECDR-CKPFHYDNECV-ACNCARRCRYKLSGRKSGGVCNCRHNTAGRHCHY-CKEGYYRKACK-ACDCHPVGACNQTTGCPCKDGVTGITCNR-CAKGYQQ......................................................................................................................................................................................................... 405
21 -19.3005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  21  190....................................................................................................................................................................................................DQSRDRSLCHGKGFLE--CGICRCDTGYIGKNCE--CQTQGRSSQELEGSNNSIICSGLGDCV---GQCLCHTSIYGQYCE--CDTINCERYNGQVCGGPGRGLCF--GKCRCHPGFEGSACQ.................................................................................................................................................................................................................. 313
22 -18.9004ove_A mol:protein length:437 Netrin-1  ali model follow..  20  264....................................................................................................................................................................................................KCNGHAARCV---RDRDDSLVCDCRHNTAGPECDR-CKPFHYDNECV-ACNCARRCRYKLSGRKSGGVCNCRHNTAGRHCHY-CKEGFYRKAC-KACDCHPVGACNQTTGCPCKDGVTGITCNR-CAKGYQQSRSPIA----------PCIKIPVA................................................................................................................................................................................. 435
23 -18.6004plm_A mol:protein length:432 Netrin-1  ali model follow..  22  263....................................................................................................................................................................................................KCNGHASRCV---RDRDDNLVCDCKHNTAGPECDR-CKPFHYDNECV-ACNCARRCRYKLSGRKSGGVCLCRHNTAGRHCHY-CKEGFYRKACK-ECDCHPVGACNQTTGCPCKDGVTGITCNR-CAKGYQQSRSPIA-PCIKIP............................................................................................................................................................................................ 432
24 -18.3004zxb_E mol:protein length:894 Insulin receptor  ali model follow..  11  3................YPGEVCPGMDIRNNLT---RLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSEGNCSQPDDKCACRNFYLDGRCVETCPPPYYHFQ-DWRCVNFSFCQDHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTCLGPKVCQELRGCTVING......................................................................................................................................................................................................................... 338
25 -18.2001npe_B mol:protein length:164 Laminin gamma-1 chain  ali model follow..  29  24...........................................................................................................................................................................................HCPTGTAGKRCELLCRPCQAVGNCNRLTGECLCIYNTAGFYCDR-CKEGFFGNKCKAACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGT-CDPGYYNLQSGQGCE........................................................................................................................................................................................................................................... 163
26 -18.1002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  23  24...........................................................................................................................................................................................RCNDELEPSQCTAACKSCREAPGPF--PGKLICEDIYWGADPGPFCTPRPWG-----------DCCDKAFCNKNPPTCRCMDE--VKECADAC------KDCQRVESSEPPR-------YVCKDRFTG-HPGPVCKP............................................................................................................................................................................................................. 132
27 -17.7002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  15  74.........................................................................................................................................................................................................SLRSLDKGIMAD-PTVNVPLLGTVPHKASVV--------QVGFPCL---GKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGT................................................................................................................................................................................................................ 181
28 -17.4003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  19  1..................................................................................................................................................................................................GSACEPECQEDAGNKVCS--LQCNNHACGWDGGDCSLN------------FNDPWKNC---------TQSLQCWKYFSDGHCDSQCNSLFDGFDCQRA-DHFSDGHCDQGC-NSAECEWDGLDCAEH................................................................................................................................................................................................................ 119
29 -17.2002y38_A mol:protein length:403 LAMININ SUBUNIT ALPHA-5  ali model follow..  19  265...........................................................................................................................................................................................RC-------VCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDR-CCPGFNQNECQ-SCNCHYDCYNQDNVYQGGGVCLCQHHTTGINCER-CLPGFFRHVCR-PAAA.......................................................................................................................................................................................................................................... 397
30 -17.2005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  17  424...........................................................................................................................................................................................ECRCRDQSRDR----SLCHGKGFL--ECGICRCDTGYIGKNCE--CQTQGRSSQCRKD-NNSIICSGLGDCV---GQCLCHTSIYGQYCE--CDTINCERYNGQVCGGPGRGLCF--GKCRCHPGFEGSACQCERTT----EGCLNPRRVECS-GRGRCRC-------------------------------------------------NVCECHSGYQLPLCQEGCPSPCGKYISCAEC-LKFEKGPFGKNCSAACP................................................................................... 626
31 -16.6001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  20  7...........................................................................................................................................................................................ELRPGSLERECKEECASCQNGGSCKDQLQICFCLPAFEGRNCETHKD------DQLICVNENGGCEQ--YCSDHTGTCRCHEGYSLLADGVSCTP--------VEYPCGKIPILEKRN-ASKPQG......................................................................................................................................................................................................................... 151
32 -16.4001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  23  33..........................................................................................................................................................................................ENTEKTNEFWKQYDQCEPCLNGGLCKDDINECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGAD---------SKVLCSCTTGYRLAPDQKSCKP--------VPFPCGRVSVSHSPTT............................................................................................................................................................................................................................... 143
33 -16.3001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  23  1.............................................................................................................................................................................................SKHVDGDQCLVL-SLCCGHGTCIDGIGSCDCRSGWEGRFCQREVSF----LNCS-----LDNGGCTHYCLEEVGWCSCAPGYKLGDDLLQCHP-------AVKFPCGRPWKRMEKKR............................................................................................................................................................................................................................... 111
34 -16.3001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  19  6.........................................................................................................................................................................................................................EEMKKGHLERECEETCSYE--GDQCE-----TSPCQNQGKCKDGLGECTCLEGFEGKNCELFT------RKLCSLDNGDCDQFCHEEQNCSCARGYTLADNGKACIP............................................................................................................................................................................................................. 126
35 -16.1002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  25  119.....................................................................................................................................................................................................................VTYDSFCSNGVTHRNQPGDCDGVQINVPCECRCRDQSRCHGKGFLE---GICRCDTGYIGKNCEGSCRKDNNSIICSGLGDCVCGQ-------CLCHTSIYGQYCE.................................................................................................................................................................................................................. 274
36 -15.7003i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model follow..  18  2..................................................................................................................................................................................................EEACELPCQEDAGNKVCS---LQCNNHAGWDGGDCSL------------------NFNDPWKNC---TQSLQCWKYFSDGHCDSQCNSLFDGFDCQRA-DHFSDGHCDQ---NSAECEWDGLDCAEHVPE............................................................................................................................................................................................................. 123
37 -15.6004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  21  453...........................................................................................................................................................................................NCDCQKEVEVNSSKCHHGNGSFQC----GVCACHPGHMGPRCE--CGEDMLSTDSCKEAPDHPSCSGRGDCY---GQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCD--GECVCRSGWTGEYCNCTTSTDSCGVLCSGRGDCVC----GKCVCTNPGASGPTCERC........................................................................................................................................................................ 617
38 -15.4002oo4_A mol:protein length:234 Neurogenic locus notch homolog protein 2  ali model follow..  19  1..................................................................................................................................................................................................GATCLSQCADKARDGVCDEACNSHAC--QWDGGDCSLTMEN----ANCSSPLPCWD---INNQCDELCNTVEC--LFDNFECQGNSKTCKYDKYCA---DHFKDNHCNQ---NSEECGWDGLDCAADQPEN............................................................................................................................................................................................................ 120
39 -15.3001k7t_A mol:protein length:186 agglutinin isolectin 3  ali model follow..  22  1.......................................................................................................................................................................................................ERCGEQGSGMEC--PNNLCCSQYGYCGMGCGKGCQNGAGGKTCPNNCSQYGHCGFNNLCCSQWGYCGLGSEFCGEGCQNPCGKDAGGRVCTNNYCCSKWGSCGIGPG-YCGAGCQSGGCDGVFAEA............................................................................................................................................................................................................ 176
40 -15.1001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  23  4...................................................................................................................................................................................................DGCLS--NPCFPGAQCSFPDGSCFCPVGFLGNGTH--CED----DECALVPDICFSTSKVPRCVNTQPGCPCPPRYRGNQPVQVCEP---ENPCKDKTHCHKHAECIYLGHCECQTGYAGDGLI.................................................................................................................................................................................................................. 143
41 -14.7003u3p_A mol:protein length:313 Tumor necrosis factor receptor superfamily me  ali model follow..  19  24.......................................................................................................................................................................................LTCDKCPAGTY-EHCTNTCSSCPVGTFTRHENGIEKCHD------CSQPCPWPMI-ALTDRECTCPPG-QSNATCAPHT---VCPVGWEDVRC-KQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPG-TDNVCG.................................................................................................................................................................................................................. 171
42 -14.7004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  19  433.....................................................................................................................................................................................................CDCACQANNGNGEC----GVCRCGPGWLGSQCE--CSEEDYRPSQQDECSPREGCSQRGECL---GQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCS--GDCLCDSDWTGYYCNTDTCMSSNGLLCSGRGKCEC----GSCVCIQPGSYGDTCEKC--------------------------TCPDACTFKKECVECKKFDRGALHDEN-TCNRYCRDEIESVKELKDTGKDAVNCTYKNEDD................................................................................. 662
43 -14.7001fax_L mol:protein length:96 FACTOR XA  ali model follow..  30  4..................................................................................................................................................................................................GDQCET--SPCQNQGKCKDGLGECTCLEGFEGKNCEL---------FTRKLCS-LDNGDCDQFCHEEQASCSCARGYTLADNGKACIP-------TGPYPCGKQTLER................................................................................................................................................................................................................................... 96
44 -14.3001wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  18  1..........................................................................................................................................................................................ERCGEQGSNMECPNLC--CSQYGYCG--MGGDYCGKGCQNGACWTSKRCGSQAGG--ATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGFCGL-GSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKGIGPGYCGAGCQSGGCDG.......................................................................................................................................................................... 171
45 -14.2003fl7_A mol:protein length:536 Ephrin receptor  ali model follow..  13  173.................................................................................................................................................................TRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCV-----------------DHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVDACQACSPGFFKFECL-ECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKYSVTCEQCWPESGECGPC------EASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQE--GQGAGSKVHEFQTLSPEG........ 530
46 -14.2004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  26  8......................................................................................................................................................................................PRCPRAACQAKRGDQCDREC----NSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSCDPAC-------SSPACLYDNFDCHAGGRERTCNPEKYCADHFADGRCDQGCN-------------TEECGWDGLDCASEVPAL............................................................................................................................................................................................................ 130
47 -14.2002v5y_A mol:protein length:731 RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE MU  ali model follow..  16  1...................................................................................................................................................................................................................ETFSGGCLFDEPYSTCGYSQS------GDDFNWEQVNTLT-SGSFMLVNASGRPEGQRAHLLLPQLKENDTHCI------DFHYFVSSKSNSPPGEVITSGHQGYLAIDEVKVLGHPCT-RIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMITEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQLNANSINGDGPIVAREVEYCTASG-SWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGGTGSPGPALRTRTKCADPMRGPR... 364
48 -14.1003eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  21  2..................................................................................................................................................................................................EEACEPECQEDAGNKVCSLQCNNHAC--GWDGGDCSLQCWKYFSDGHCDSQC-------NSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGC-------------NSAECEWDGLDCAEHVPE............................................................................................................................................................................................................. 123
49 -14.0002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  20  3...................................................................................................................................................................................................RGCARWCP---QDSSCVN-ATACRCNPGFSSFSEIITTP----METCDDINECATLCGKFSDCWNTEGSCVCSPGYEPVSGAKTFKNES-ENTCQDECSCDSSTVCFNTVGCRCRPGWKPRHGIPNN............................................................................................................................................................................................................... 136
50 -14.0003w14_E mol:protein length:609 INSULIN RECEPTOR DOMAINS L1-CR-L2-(FNIII-1)-A  ali model follow..  15  180............................................................................................................................................................................ERCWTHSHCQKVCPTICKSHGCTAECHSEC------GNCSQPDDKCVCRNFYLDGRCVETCPPPYYHFQ-DWRCVNFSFCQDHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCT-----PCLGPCPKVCHLLEGERGCTVIN............................................................................................................................................................................................................... 337
51 -13.7003s2k_C mol:protein length:97 Dickkopf-related protein 1  ali model follow..  19  1...................................................................................................................................................................................................................................ADPMYHTKGQEGSVCLRSSD----CASGLCCARHFWSKICKPLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKHHQASNSSRLHTCQR................................................................................................................................................................................................................. 91
52 -13.6003g5c_A mol:protein length:510 ADAM 22  ali model follow..  15  216.................................................................................................................GNGFIETGEECDCGTPAECVLEGAECCKKCTTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGN-SSQCAPNIHGYSCDGVQGICFG-GRCKTRDRQCKYIWGQKVTASDKYCIEGTEKGNCGKDKDTWIQCNRDVLC----GYLLCTNIGNIPRLGENCSGGHVGTPCEHRCICSGNGVCSNELKCVCNRHWIGSDCNTYFPHN............................................................................................................................................................................................................ 486
53 -13.4004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  18  423.....................................................................................................................................................................................................CECRCSLCHGKGFLE---GICRCDTGYIGKNCE--CQTGRSSQELEGSCNNSIICSGLGDCV---GQCLCHTSIYGQYCE--CDTINCERYNGQVCGGPGRGLCF--GKCRCHPGFEGSACQCERTT----EGCLNPRRVECS-GRGRCRC-------------------------------------------------NVCECHSGYQLPLCQPGCPSPCGKYISCAEC-LKFEKGPFGKNCSAACP................................................................................... 626
54 -13.2004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  19  259......................................................................................................................................................................................SRCTTHCWPYKSGGNCFRSLP-DMSTGECQDFRSSTCAEDDTNAFYCETKCPPRE-GKYCKPMNARSLSNATAEQCGQMLSSADGSSLSSQVRGYHKCFFYSTVPECLDKCDCGAHGTCDVAT-CVCEPGFTGERCDAA................................................................................................................................................................................................................ 503
55 -13.1002wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  18  1..........................................................................................................................................................................................ERCGEQGSNMECPNLC--CSQYGYCG--MGGDYCGKGCQNGACWTSKRCGSQAGG--ATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQSGGKLCPNNLCCSQWGFCGL-GSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSKGIGPGYCGAGCQSGGCDA.......................................................................................................................................................................... 171
56 -13.0003me2_R mol:protein length:216 Tumor necrosis factor receptor superfamily me  ali model follow..  18  37......................................................................................................................................................................................GRCCSRCEPGKY-SKCTPVCLPCGPDEYLDTWNEEDKCLL------HKV-CDAGK--DPGNHTAPRRCACTAGYHWNSDCECCECAPGFKDTVC-TPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQG-SDVVCS.................................................................................................................................................................................................................. 188
57 -13.0005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  12  315............................................................................................................................................................................................IPKSAVGELSEDSSNNALPDTLK--VTYDSFCSNGVTHRNQPGDCDGVQINVPITFQCECRCRCHGKGFLE---GICRCDTGYIGKNCE--PAALQ--TLFQGPLGAQGKKKLQALKKKNAQLKWKLQALK.................................................................................................................................................................................................................. 498
58 -12.9002x10_A mol:protein length:545 EPHRIN TYPE-A RECEPTOR 2  ali model follow..  12  33LLDFAAAGGELGWLTHYMYSVCNVMSGDQDNWLRTN-----VYRGEAERIFIELKFTVRDCNSF----------GGASSCKETFNLYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPL-----------------------TRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCV----------DHAVVP-------PGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDAQACSPGFFSESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQE--GQGAGSKVHEFQTLSPEGSGNG.... 537
59 -12.9001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  22  10..........................................................................................................................................................................................................DTICKNGQLVQMSNHCMCNEGLVENTCEEECKKETLGKACGEFGQCIEN-----PDPAQVNMCGCIEGYT-DVCQYSCAIGKVEKKCTKTGETADNEVCKNVEGCQCMEGFTFDKEKNVC............................................................................................................................................................................................................... 177
60 -12.8001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  18  3.....................................................................................................................................................................................................................................QVICRDEKTQMIYQQHQSWLRPVLRSNRVE----YCWCNSGRAQCHSVPV-------KSCSEP-RCFNGGTCQQALYCQCPEGFAGKSCEID................................................................................................................................................................................................................ 87
61 -12.7004ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  14  146..................................................................................................................................................................................................GNNCLDAAKACNLDDTCKKSAYITPCTTSMSNEVCNRKCHKAL-DIACTER-VCSYEERERPNCLSLQDSCK-----TNYICRSRLAD--FFTNCQPESRSVSN--CLKENYADCLLAYSGLIGTVMTPNYVDSSSLSVAPWCDCSNGNDLEDCLK................................................................................................................................................................................... 322
62 -12.7004bk4_A mol:protein length:568 EPHRIN TYPE-A RECEPTOR 4  ali model follow..  13  48..........................................SRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWIT-GAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCV--------------------NNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHERSGECQACKIGYYDATCA-KCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS----KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPN-GVILEYEVKYYEKDQNESYRIVRTAARNTDIKGLNPLTSYVFHVRAR--TAAGYGDFSEPLEVTTNTVPSRIIG.... 553
63 -12.6002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  23  5..........................................................................................................................................................................................................DECESNGVCKNSPGSCECSSESTKTICIETCWQTVIDGRCESQCCSSLGAAWGSPCTLCQVDPICGKGYSGTQCED--------DECEVFPGVCKNGLCVNTRGCQCPSGMTGRIC................................................................................................................................................................................................................... 146
64 -12.5004aqt_A mol:protein length:375 LAMININ SUBUNIT GAMMA-1  ali model follow..  20  254...........................................................................................................................................................................................RC-------KCNGHASECV---KNEFDKLMCNCKHNTYGVDCEK-CLPFFNDSECL-PCDCNGRSQELYRSTGHGGHCNCRDNTDGAKCER-CRENFFRLGNTEACSAAA........................................................................................................................................................................................................................................ 369
65 -12.4001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  20  4...................................................................................................................................................................................................NECLDPTTCI--SGNCVNTPGSCDCPPDFERVGCVDSNEIGVGVSKASCCCSLGKAWGTPCEMCPAVNTCPGGEGFRPNPITVILED----DECQELPGLCQGGKCINTFGCRCPTGYYTRVCD.................................................................................................................................................................................................................. 162
66 -12.4004oga_E mol:protein length:317 Insulin receptor domains L1-CR  ali model follow..  16  205..................................................................................................................................................................................................GLCCHSECLGNCSQP---DDPTKCVCRNFYLDGRCVETCPPPYYHFQ-DWRCVNFSFCQD---LHKCKNSRRGCHQYVNNKCIPECPSGYTMNSSNLLCT-----PCLGPCPKSSSLV......................................................................................................................................................................................................................... 315
67 -12.1001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  18  6..........................................................................................................................................................................................EEVKQGNLEREC-------LEEACSLEEAREEDAEQTDEFWSKYKDGDQ------CE-----GHPCLNQGHCKDGIGDCTCAEGFEGKNCE............................................................................................................................................................................................................................................................ 82
68 -12.0005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  18  3................................................................................................................................................................................CTKFKVSSCRE-C---ESGPGCT--CQKLNFTGPGDPDSIRCDTRPQLLMRGCAADCSNGVTHRNQPRKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRS-----LCHGKGFLE--GICRCDTGYIGKNCE.................................................................................................................................................................................................................. 221
69 -11.9004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  22  490..........................................................................................................................................................................................................................SCAVSKRRLECEECGGLGSPTGRCEWR-DGKGITRNFSTCSPSTKTCHCDVTQDINICPQDCLRGSIGIKAGYTCNCFPEE-----EKCFCEPEIQDPLCDELC............................................................................................................................................................................................................... 606
70 -11.8001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  22  6...........................................................................................................................................................................................PCFRA----NCEYQCQPLDQTSY------LCVCAEGFAPHRCQMFCNQT----ACPADCDPNTQ-----------ASCECPEGYILDD----------GFICTDIDECENGGFCSGV--CICGPDSAGTDC................................................................................................................................................................................................................... 118
71 -11.8004zsz_A mol:protein length:296 Uncharacterized Fusion Protein  ali model follow..  16  201......................................................................................................................................................................................ERCRLAA------HHCIHACERYLA--LCTESSREQR-----HAGDCADLCRAPAACELAARYAL---ACAER--CDGDEPLER--------ECAGAC------RRFVAACH........................................................................................................................................................................................................................................... 293
72 -11.8003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  22  6...........................................................................................................................................................................................PCFRA----NCEYQCQPLNQTSY------LCVCAEGFAPHRCQLFCNQT----ACPADCDPNTQ-----------ASCECPEGYILDD----------GFICTDIDECENGGFCSGV--CICGPDSA....................................................................................................................................................................................................................... 109
73 -11.8001skz_A mol:protein length:119 ANTISTASIN  ali model follow..  18  5....................................................................................................................................................................................................GPGCEEAGCPEGSACNIITDRCTCS----GVRCRVHCPHGFQRYGCE-FCKCRLECPEGMMCSRLTNKCDCKI---DINCRK-TCPNGLKRDCE-YCECRPKRKLIPR................................................................................................................................................................................................................................. 117
74 -11.7004c8v_A mol:protein length:121 R-SPONDIN-2  ali model follow..  18  7....................................................................................................................................................................................................PICKGCLSCSKDNGCLR------CQPKLQYGECLQSCPPGYYGVRGPDMNRCSRCRIENCDSCFSRDFCKCKSGFYKGQCFEECPEGFAPLDDTMVCDGTK........................................................................................................................................................................................................................................ 115
75 -11.7004c99_B mol:protein length:122 R-SPONDIN-2  ali model follow..  16  5....................................................................................................................................................................................................PICKGCLSCSKDNGCSR------CQQKLQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCKCKVGFHRGRCFDECPDGFAPLDETMECEGT......................................................................................................................................................................................................................................... 112

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.