current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MSSGVDLGTENLYFQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGMLLast
1 -113.0004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model  100  1MSSGVDLGTENLYFQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML 261
2 -100.0002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  38  1................MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQR-HGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMV 245
3 -99.7003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  43  2.................SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQR-SGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMY 245
4 -99.7002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  37  1...............MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQK-SGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLV 246
5 -99.0004jro_A mol:protein length:271 FabG protein  ali model follow..  37  18..............AMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQR-AGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMV 264
6 -98.8001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  40  1...................SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKR-KGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIA 243
7 -98.5003woh_A mol:protein length:251 SiaM  ali model follow..  40  2..........SMTGPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKR-SGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK-RLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMA 250
8 -98.4004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  37  1MSSGVDLGTENLYFAMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSR-FGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKAYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLY 264
9 -96.3004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  31  1...............MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCD-VQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQG-KGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMS 245
10 -95.7002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  37  1.............MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRW-GRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF 248
11 -95.7004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  40  1..............MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQK-SGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNA--EPILQFIPLARYGQPEEVAGTIRFLATDPAAYITGQTFNVDGGMV 245
12 -95.4004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  36  4............QLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLF 260
13 -95.3003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  34  1.............MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGW-GRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLH 248
14 -95.3003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  37  1...............MSLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRW-GRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMY 245
15 -95.2004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  38  3..............TQDLSGKIALVTGASRGIGAAIADTLAAAGAKV-IGTATSESGAAAISERLAQWGGEGRVL--NSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQRA-GRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGML 246
16 -95.2002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  39  2....................RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLAVLGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKAR-FGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLT 243
17 -94.9004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  41  4.SSSGLVPRGSHMTALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQR-SGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAA--EKLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLV 261
18 -94.9004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  38  1...............MAMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGW-GRIVNISSVNGSKGSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILDILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQH 247
19 -94.8004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  37  6....YDIPTENLYFQGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGW-GRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLH 262
20 -94.8002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  37  1.............MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLF 256
21 -94.7004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  47  1MSSGVDLGTENLYFQSMLQGKVALVTGASRGIGQAIALELGRLGAVV-IGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARW-GRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQRELLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMY 261
22 -94.6003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  38  3MGTLEAQTQGPGSMDKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARG-GRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTLKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMF 262
23 -94.5003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  36  4...............SGSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGW-GRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLH 249
24 -94.2002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  41  28.............YYYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNR-YGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIKKIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGL. 273
25 -94.2004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  1...............MSTDKRVAIITGAANGIGRATALEFAQAGYHV-VAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAK-YGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMV 254
26 -93.8003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  38  2..AMGTLEAQTQGPGSMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRF-GRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMH 261
27 -93.4004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  31  1.............MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN-----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQG-KGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIM 243
28 -92.0003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  37  1........SNAMSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKV-IGTATSESGAQAISDYL---GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQ-GRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTTLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY 249
29 -91.9003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  41  5..............MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHG-TREEKLKELAAEL---GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRN-GRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQKDIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMA 247
30 -91.9004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  24  14..............MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFG-ETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAK-KGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY. 260
31 -91.9004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  34  1..............MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLG----------DLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNG-YGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMR 239
32 -91.5004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  36  2.............LSLGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATDGG-----------NTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYERK-AGSIVAISSISGERGNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIREITKEIPFRRFGKPEEIAWAVAFLLSPVASYVTGEVLRVNGAH. 238
33 -91.4005cdy_A mol:protein length:244 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  39  1...............MSFEGKIALVTGASRGIGRAIAELLVERGACV-IGTATSEKGAEAISAYL---GENGKGLMLNVVDPTSIDTVLATIRAEFGEVDILVNNAGITRDNLLMRMKDDEWQDIIDTNLTSVFRLSKAVMRAMMKKRF-GRIITIGSVVGTMGNAGQVNYAAAKAGVIGFSKSLAREVASRGITVNVVAPGFIETDMTRTLTDDQRAILAQVPANRLGDAKEIASAVAFLASDEASYISGETLHVNGGMY 242
34 -91.4001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  29  1.............MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMT 251
35 -91.4001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  41  1...............MNFEGKIALVTGASRGIGRAIAETLAARGAKV-IGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH-GRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMY 242
36 -91.3003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  37  3..............MIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISG-SNEEKLKSLGNAL---KDNYTIEVCNLANKEECSNLIS----KTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRY-GRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEKQREIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGML 241
37 -91.3003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  31  5..............MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASG-SGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQV 252
38 -91.2004kms_A mol:protein length:249 Acetoacetyl-CoA reductase  ali model follow..  38  1................MAMSEIAIVTGGTRGIGKATALELKNKGLTVVANFFSNYDAAKEMEEKYGIKT-----KCWNVADFEECRQAVKEIEEEFKKVSILVNNAGITKDKMLHRMSHQDWNDVINVNLNSCFNMSSSVMEQMRNQDY-GRIVNISSINAQAGQVGQTNYSAAKAGIIGFTKALARETASKNITVNCIAPGYIATEMVGAVPEDVLAIINSIPKKRLGQPEEIARAVAFLVDENAGFITGETISINGGH. 240
39 -91.1003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  42  16..............MFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHG-TREDKLKEIAADL---GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRY-GRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLNEKQKEIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMA 258
40 -91.1003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  31  16MLVVESAEPAERKVMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGR-GRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYSGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQV 277
41 -91.1001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  29  1.............MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMT 251
42 -91.1003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  29  1...........MGMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMT 253
43 -90.9003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  26  1................MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNG-GGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRS 247
44 -90.5003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  24  1.............MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNF-GRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEARQKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAV. 251
45 -90.4004cql_B mol:protein length:244 CARBONYL REDUCTASE FAMILY MEMBER 4  ali model follow..  32  1.................MMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKA----AAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQ-GGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKE--EHLKKNIPLGRFGETIEVAHAVVFLLE--SPYITGHVLVVDGGLQ 235
46 -90.1004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  30  3.MELTEITPESLRLRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEAR-RGWIVNTSSVAGKTYSIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLY 265
47 -89.9003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  31  1..............TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDIN----AEGAKAAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMV 245
48 -89.7001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  33  1...............MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDI-EEGPLREAAEAVGAHP-----VVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNP-GSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRT 239
49 -89.3004da9_A mol:protein length:280 Short-chain dehydrogenase/reductase  ali model follow..  31  1MSSGVDLGTENLSMMTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGIASIVRFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLASRASRSIINITSVSAVMTSPERLDYCMSKAGLAAFSQGLALRLAETGIAVFEVRPGIIRSDMTAAVSGKYDGLIGLVPMRRWGEPEDIGNIVAGLAGGQFGFATGSVIQADGGLS 270
50 -89.2001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  30  1MGSSSSGLVPRGSHMATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCAR-GEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKA-MLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGL. 272
51 -89.0003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  28  2.........SHMAGIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADL-DVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVR 261
52 -88.7001uzl_A mol:protein length:247 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE  ali model follow..  37  11...............PPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKG------------LFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKF-GRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGM. 243
53 -88.6002nm0_A mol:protein length:253 Probable 3-oxacyl-(Acyl-carrier-protein) redu  ali model follow..  34  4........SSSGLVPRSHMSRSVLVTGGNRGIGLAIARAFADAGDKVAITYRSGEPPEG------------FLAVKCDITDTEQVEQAYKEIEETHGPVEVLIANAGVTKDQLLMRMSEEDFTSVVETNLTGTFRVVKRANRAMLRAKK-GRVVLISSVVGLLGSAGQANYAASKAGLVGFARSLARELGSRNITFNVVAPGFVDTDMTKVLTDEQRAIVSQVPLGRYARPEEIAATVRFLASDDASYITGAVIPVDGGL. 243
54 -88.3001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  29  9..............TISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQL 263
55 -88.1003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  28  3..........SYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDL-KSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAG-GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGV 252
56 -88.0004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  22  1...........MAMGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVW 258
57 -87.8004yxf_A mol:protein length:257 MupS  ali model follow..  23  3.DAVSDALHTRHDSAPSAVKGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSERADFHW-----QALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRG-AGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDMVKDLSPQTSRIERRTPLGRLGTQQEVADLILYLVDR-GTFVTGQNIAVDGGFT 256
58 -87.5002ntn_A mol:protein length:267 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  37  25...............PPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKG------------LFGVEVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKF-GRMIFIASVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGM. 257
59 -87.4004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  27  1...........MAMTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADL-LDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGR-GRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWRHQLTLIPQGRAQTPEDMGRLALFFATMD--NVTGQAVNVDGGFT 258
60 -87.4003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  29  3..............LQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK---GGAIVTFSSQAGRDGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTFPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVL 249
61 -87.1004one_A mol:protein length:262 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  27  1.............MAMSRQRPVALVTGGRRGIGLGIARALAAKGFDLAITDRES---DEAVIHELRGLGGKVAFFKSDLAAVKTHEATVFAVLDAFGGIDCLVNNAGMVERGDFLALKPENFDTIMDVNLRGTVFFTQAVVKAMLAADEVRSIVTISSVSSVMTSPERLDYCISKAGLTAFVQGLALRLAEARIGVFEVRPGIIRTDMTAKVAARYDALIGLVPMKRWGEASDVGAIVAGLAGGDFIFATGSAIHADGGLS 252
62 -87.0003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  28  4..............SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADI-NAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRG-GGAIVNQSSTA---AWLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQI 250
63 -87.0001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  32  1..................MKKVALVTGAGQGIGKAIALRLVKDGFAVAIADY-NDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMV 254
64 -86.9004qec_A mol:protein length:248 ElxO  ali model follow..  27  1..................MKKNVLITGGFKGIGKQVALEFLKNDYHVCITS-RYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVS-CGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYL 246
65 -86.9003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  29  3..............HMSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDV-KQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLV 260
66 -86.7005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  25  1..............MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAAR-SEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVG-GGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAALENDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFA 250
67 -86.7002cf2_E mol:protein length:226 FATTY ACID SYNTHASE, KR DOMAIN  ali model follow..  41  1...............MNFEGKIALVTGASRGIGRAIAETLAARGAKV-IGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRH-GRIITIG---------GQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETSDDQR-----AGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM. 226
68 -86.6004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  29  3..............MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGE---GASIINISSVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSASDLEAQVLGQTPLGRLGEPNDIASVAVFLASDDARWMTGEHLVVSGGL. 249
69 -86.5004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  29  1.............MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQY 256
70 -86.5003sju_A mol:protein length:279 Keto reductase  ali model follow..  30  13..............SHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCA-RDAKNVSAAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRA-MREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGL. 270
71 -86.5001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  25  6..............NLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGV 251
72 -86.5001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  25  1...............MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADI-NLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNW 254
73 -86.5004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  26  1.............MFSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASAKASAVISTGSIAAREGGGGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQI 256
74 -86.4003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  29  1.............MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQY 256
75 -86.4004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  26  1.............MFSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASATTSAVISTGSIAAREGGGGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQI 256

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.