current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4fbr_A mol:protein length:267 Myxobacterial hemagglutinin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MAAYLVQNQWGGSQATWNPGGLWLIGARDKQNVVALDIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSAPWQPGGVWVLGARDKQNIVAVSIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDTYSVENQWGGSAAPWHSGGVWVLGTRGKQNVINVDAKSNDGGKTLSGTMTYNGEGPIGFRGTLTSPDTYTVENQWGGSTAPWNPGGFWMIGARNGQNVVALNVASSDGGKTLAGTMIYNGEGPIGFRARLGLast
1 -101.0004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model  100  1MAAYLVQNQWGGSQATWNPGGLWLIGARDKQNVVALDIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSAPWQPGGVWVLGARDKQNIVAVSIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDTYSVENQWGGSAAPWHSGGVWVLGTRGKQNVINVDAKSNDGGKTLSGTMTYNGEGPIGFRGTLTSPDTYTVENQWGGSTAPWNPGGFWMIGARNGQNVVALNVASSDGGKTLAGTMIYNGEGPIGFRARLG 267
2 -89.1004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  63  13.NLQHVQNQWGGSSAPWHEGGMWVLGCRSGQNVVALNIKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNTYAVENQWGGSSAPWHPGGTWVIGCRVNQQVVALDIESGDQGATLAGTMTYAGEGPIGFKSQQADGGVYAVENQWGGSSAPWHNGGVWVIGAR-DQAVVAVSIGSTDSGKTLNGNMTYAGEGPIGFKGNSVAGNNYAVENQWGGTSAPWHPGGIWLLGCRSGQNVVELYITSGDNGNTFHGSMTYSGEGPIGFRAMA. 276
3 -42.9004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  13  244.LHGTCQQ---PWQCNCQEGWG---GLFCNQDLNYCHKPCKNGATCTNGQGSYTCSCRPGYTGATCELGIDE------CDPSPCKNGGSCTYGKICELSAMTCDGPCFNGGRCSDSPDGYSCRCPVGYSGFNCEKKIDY------CSSSPCSNGAKCVSGRHCDDNVDDCSSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQRCECARSYGGPNCQFLLPELAVVDLTEKLEGQGGPFPWENLY..... 529
4 -39.2004fbo_A mol:protein length:133 Pseudomonas fluorescens agglutinin  ali model follow..  63  1MSKYAVANQWGGSSAPWHPGGTWVLGARDNQNVVAIEIKSGDGGKSFTGTMTYAGEGPIGFKAQRTGQNQYNVENQWGGNDAPWHPGGKWVIGGRDNQNVIALSVTSSDGGKNLSGTNTYANEGPIGFRGQ........................................................................................................................................ 131
5 -38.8005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  16  1.............................SAQADPCSNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQ----KPGLCRHGGTCH-----------------------NEVGSYRCVCRATHTGPNCERPYVP------CSPSPCQNGGTCRP----------------------TGDVTHECACLPGFTGQNCEENIDDCPGNN-----------------------------CKNGGACVDGVNTYNCRCPPEWTGQ.. 153
6 -38.0005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  17  6....................................SNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNE------CGEKP---------------------GLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVP------CSPSPCQNGGTCRP----------------------TGDVTHECACLPGFTGQNCEENIDDCPGNN-----------------------------CKNGGACVDGVNTYNCRCPPEWTGQ.. 150
7 -35.9002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  15  12....................................ANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNE------CVSNPCQNDATCL-----------------------DQIGEFQCICMPGYEGVHCEVNTDECASS-----------------------------PCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHH------ILDAQKMVWN............................................. 133
8 -35.3004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  15  9....................................ANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNE------CISNPCQNDATCL-----------------------DQIGEFQCICMPGYEGVYCEINTDECASS-----------------------------PCLHNGRCVDKINEFLCQCPKGFSGHLCQSGRLEVLFQ......................................................... 124
9 -34.4001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  7..................................HLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQ------CETSPCQNQGKCK-----------------------DGLGEYTCTCLEGFEGKNCELFTRKL----------------------------CSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKATSSSGEAPDSTWKPYDAATENPFDLLDFNQTQPERGDNNLTRIVG 192
10 -34.1004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  18  5....................................PNPCENGGICLPGLGSFSCECPDGFTDPNCSSVVEVASDEEECTPNPCHNGGTCE----------------ISEAYRGDTFIGYVCKCPRGFNGIHCQHNINE------CEVEPCKNG-----------------------GICTDLVANYSCECPGEFMGRNCQYKGG.............................................................. 136
11 -33.0004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  24CGGARNPGDRKCTRDECDTYFK---VCLKEYQSRVTGGPCSFGSGSVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKF---------CRPRDDFFGHYACMGPECNRAI-CRQGCSPKHGSCKL---PGDCRCQYGWQGLYCD----KCIPHPGCVHGICNEPWQCLTNWGGQLCDKDLNYCCLNGGTCSNGPDKYQCSCPEGYSGP.. 300
12 -31.8001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  1.................................................ANSFLEEMKKGHLERECMEET--------CSYEEAREVFEDSDKNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKL----------------------------CSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPT------GPYPCGKQT............................................. 136
13 -31.1002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  10  3............................................GSGSIEGRSAVTCDDYYYGFGCNKF---------CRPRDDFFGHYACDQ-------------------------NGNKTCMEGWMGPECNRAI--------CRQGCSPKHGSCKLPGDCLYCDKCIPHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGT-----HQPCLNGGTCSN----------------------TGPDKYQCSCPEGYSGP.. 159
14 -31.1001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  13..................................NLERECIEEKCSFEEAREVFENTEKTNEFWKQYVDGDQ------CEPNPCLNG-----------------------GLCKDDINSYECWCQVGFEGKNCELDATCNIKN-----------------------------GRCKQFCKTGADSKVLCSCTTGYRLAPDQKSCKPA------VPFPCGRVSVS........................................... 138
15 -30.3001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  1.................................................ANAFLEELRPGSLERECKEEQ--------CSFEEAREIFKDKLFWISYSDGDQCASPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDD------QLICVNENGGCE--------------------QYCSDHTTKRSCRCHEGYSLLADGVSCTPT------VEYPCGKIPIL---------------------------EKRNASKPQG...... 151
16 -29.6004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  20ANGRPCEPGCRTFFRICLKHYQA-----------TFSEGPCTFGNVSTPVLGTNSFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAW-QIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLC--------KKRDDHFGHYEC--------------------------QPDGSPSCLPGWTGKYCDQPI--CLSGCHEQNGYCSKPDECNPGWQGPLCNECIPHKGCRHGTCTIP---WQCACDEGWGGL.. 254
17 -29.6003s5v_A mol:protein length:133 Lectin  ali model follow..  64  1MALYNVENQWGGSSAPWNEGGQWEIGSRSDQNVVAINVESGDDGQTLNGTMTYAGEGPIGFRATLLGNNSYEVENQWGGDSAPWHSGGNWILGSRENQNVVAINVESGDDGQTLNGTMTYAGEGPIGFKGT........................................................................................................................................ 131
18 -29.5002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  10  60.WQAAGQAEYFYEFLSLRSLDK---GIMADPTVNVPLGTVPHKASVVQ----VGFPCLGKQDGVAAEVDVIVMNSEGNTILKTPQNA---IFFKTCQQAE--CPGGCRNGGFCNER---RICECPDGFHGPHCEKAL---------CTPRCMNGGLCVTPGFCNCDKANCSTTCFNGGTCFY---PGKCICPPGLEGEQCEISK----PQPCRNGGKCIGKSKCKKGYQGDLCSKPVEPGCGAHGTCHEP---NKCQCQEGWHGR.. 304
19 -25.9001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  6.........................GDQCLVLPLECASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLN----CSLDNGGCTHYCL-----------------------EEVGWRRCSCAPGYKLGDDLLQCHP------AVKFPCGRPWKRM............................................................................................................. 107
20 -25.5001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  11  2..........NSFLEEVKQGNL--------------ERECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQ------CEGHPCLNQ-----------------------GHCKDGIGDYTCTCAEGFEGKNCEFSTR................................................................................................................................. 86
21 -24.8001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  10  1.............................EAEASAVTVDICKNGQLVQMSNHFKCMCNEGLVHLSENTCEEKNECKKETLGKACGEFGQCI------------------ENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESGECIV-------------------------EYLSEIQSAGCSCAIGKVPN-------------PEDEKKCTKTGETACQLK----------CNTDNEVCKNVEGVYKCQCMEGFT.... 169
22 -23.6001fax_L mol:protein length:96 FACTOR XA  ali model follow..  10  9....................................TSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKL-----CSLDNGDCDQFCH-----------------------EEQASVVCSCARGYTLADNGKACIP------TGPYPCGKQTLE.............................................................................................................. 95
23 -22.7001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  13  1...................................................SYQVICRDEKTQMIYQQH--------QSWLRPVLRSNRV-----------------------------EYCWCNSGRAQCHSV-------PVKSCSEPRCFNGGTCQQ---------------------ALYFSDFVCQCPEGFAGKSCEIDTRAT............................................................ 91
24 -22.4004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  12  13......................................FFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQ-----ACRTNPCLHG-----------------------GRCLEVEGHRLCHCPVGYTGPFCDVDTAA................................................................................................................................ 85
25 -22.1004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  10  146...................................................SYRVVCSDNYYGDSCSRLC--------KKRDDHFGHYEC--------------------------QPDGSPSCLPGWTGKYCDQPI--------CLSGCHEQNGYCS--------------------------KPDECNCRPGWQGPLCNEAA............................................................... 230
26 -20.3002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  10  7...................................GHDALKGPNVCGS---RYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTIAPSCGSRSIQCNIRCMNGGSCSDD----HCLCQKGYIGTHCGQPV---------CESGCLNGGRCV--------------------------APNRCACTYGFTGPQCE.................................................................. 136
27 -20.0002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  1.............................SADIDECESSPCINGVCKNSPGSFICECSSEST---LDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGYS----------------------IKGTQCEDIDECEVFPGVCK-----NGLCVNTRGSFKCQCPSGMTGRIC................................................................... 146
28 -19.9004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  13  186.............VRRCEAQK---WGPECNHLCTACM----NNGVCHEDTG--ECICPPGFMGRTCE--------------KACELH---TFGRTCKERC-SGQEGCKSYVFCLPDPYG--CSCATGWKGLQCN--------------EACHPG---FYGPDCKL-----RCSCNNGEMCDRFQG---CLCSPGWQGLQCE---REGIPRMTPKIVDLPDHIEVNSGKFNPICKAS............................... 351
29 -18.4002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  1...............................DSRGCARWCPQDSSCV---NATACRCNPGFSSF---------SEIITTPMETCDDINECATLSK---------VSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECSSG----------------QHQCDSSTVCFNTVGSYSCRCRPGWKPR..................................................................... 130
30 -18.3001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  1..............................TDVNECLDPTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGGVGVSKASCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNP--------------ITVILEDIDECQELP-----------GLCQGGKCINTFGSFQCRCPTGYYTRVCD.................................................................. 162
31 -17.4001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  13  1.................................................................................................................................GTSHLVKCAE------KEKTFCVNGGECFM-------------------KDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK............................................... 67
32 -17.1001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  13.PGAQCSSFPGSWSCFCPVGFLG--GTHC-EDLDECALSTSKVPRCVNTQPGFHCPCPPRYRGNQPVGVGLEAAKT---------EKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNGDACDDDDDNDGVTDEKDNCHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGDVDNDLVGDQCDNNEDIDQNNQDNCPYISNANQADHDRDGQGD.. 347
33 -15.8001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  12  6........................................................................................................................................................................CASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA.......................................................... 46
34 -15.1002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  14  59........................................................................................TWQAAGQAEYFYEFLSLRSLDKGIMADPT---VNVPLLGTVPHKCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIQQAECPGGCRNGGFCNE---RRICECPDGFHGPHCEGT................................................................ 181
35 -14.2004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  19  2............................DIVDGDQCSNPCLNGGSCKDDINSYECWCPFGFEGKNCELL...................................................................................................................................................................................................... 43
36 -13.8005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  16  198.......................................CHGKGFLECG----ICRCDTGYIGKNCE----------------CQTQGRSSQELEGSCRKDNNSIICSGLGDCVCG----QCLCHTSIYGQYCECDTINC---------ERYNGQVC---------------GGPGRGLCFCG----KCRCHPGFEGSACQ.................................................................. 313
37 -13.7002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  12  1..............................................MKPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSH------------------------------VCNDLKIGYECLCPDGFQ-----------------AQRRCEDIDECQDPDTCSQ-------------LCVNLEGGYKCQCEEGFQTKACK.................................................................. 101
38 -13.7001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  18  3.......................................................................................................................................................................SCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE.............................................................. 40
39 -13.6001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  16  9.................................................................................................................................................SYDGYCLNGGVCMH---------------------IESLDSYTCNCVIGYSGDRCQTRDLRWWE.......................................................... 51
40 -13.4001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  12  16..HGQCINTDGSYRCECPFGYI-LAGNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEMMTCE........................................................................................................................................................................................................ 82
41 -13.4004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  250..............................TGPFECSILSRCTTHCWPYKSGGNCF-PAMFDMSTGECRLLGYHTQDFRSSTCAELTTDDTNAFYCVRPMKTAASSNMVYVTSHTR-PDHETKCPPREPLKNVR--------------------GVVSKGKYCKPMNARASLSNATAEQCGQRLMLSSADGSSLSSQVRGYHWATFVATDCNMGSCAATARGKCFFYSTVPECLIHSSVDCGAHGTC--DVATGKCVCEPGFTGE.. 498
42 -12.9001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  2.............................DIDECRISPDLCGRGQCVNTPGDFECKCDEGYE-------------SGFMMMKNCMDIDECQRDP-----------LLCRGGVCHNTEGSYRCECPPGHQISAC...................................................................................................................................... 85
43 -12.4003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  12  2..............................EPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQLFCNQTACPADCDPNT------------------------------QASCECPEGYIGFICT------------DIDECENGGFC-------------------SGVCHNLPGTFECICGPDSA....................................................................... 109
44 -12.1003ltf_D mol:protein length:58 Protein spitz  ali model follow..  16  2...............................................................................................................................FPTYKCPET---------FDAWYCLNDAHCFA---------------------IADLPVYSCECAIGFMGQRCEYKE............................................................... 50
45 -12.0005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  10  434....................................RSLCHGKGFLECGI----CRCDTGYIGKNCE----------------CQTQGRSSQELEGSCRKDNNSIICSGLGDCVCG----QCLCHTSIYGQYCECDTINCERYNGCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCN----VCECHSGYQLPLCQE---PGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKESEGCWVAYT.... 653
46 -12.0001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  21  9........................................................................................................................................................................SYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCE.................................................................. 43
47 -11.9002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  22........................................................................................................................QWRCNDELEPSQCTAACKS-----------CREAPGPFPG---------------------------KLICEDIYWGADPGPFCTPRPWGDCCDKAFCNKMPTCRCMDEVKECADACKDCQRVESSEPP-----RYVCKDRFTGHPG 127
48 -11.9002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  10  120...................................................TYDSFCSNGVTHRNQPRGDVPITFQVKVTATECIQEQSFVIRCECRCRDQSRDRSLCHGGFLECG----ICRCDTGYIGKNCE----------------CQTQGRSSQELEGSCRKDNNSIICSGLGDCVCG----QCLCHTSIYGQYCE.................................................................. 274
49 -11.6001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  12  2..............................EPVDPCFRANCEYQCQPLDQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPNT------------------------------QASCECPEGYIGFICT------------DIDECENGGFC-------------------SGVCHNLPGTFECICGPDSA....................................................................... 109
50 -11.5003gcw_E mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  10  18....VCNDLKIGYECLCPDGFQLVAQRRCE-DIDECQDPDTCSQLCVNLEGGYKCQCEEGFQ............................................................................................................................................................................................................. 74
51 -11.4003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  1.........................GSACELP--ECQEDAGN-KVCSLQ----CNNHACGWDGGDCSLNFNDPWKNC-----------------------------------------TQSLQCWKYFSDGHCDSQ---------CNSAGCLDGFDCQRAGQCNPLYDQYCKDHFSDGHCDQG----CNSAECEWDGLDCAEHV---------PERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFK............ 162
52 -11.2004wnx_A mol:protein length:433 Netrin-4  ali model follow..  222...YAVYDFIVKGSCFCNGHADQCLPVEGFRPIKAPGAFHVVHG---------RCMCKHNTAGSHCQHCAPLYNDRPWEAADGRTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCNNCQHNTEGQHCQRLRRPFSAPDACKACSCHPVGS-------------AILPFSSVTFCDPSNG--DCPCKPGVAGPHCDRCMVGYWGFGDYGCRPCDCAGSC........................................... 426
53 -11.1001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  9..........................................................................................................................................................................KKQCPQNSGCFRHLEREECKCLLNYKGDKC---VENPNPTCNENNGGCDADAKCT------------------EEDSGSNGKKITCECTKPDSYPLF 87
54 -11.0001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  2...................................................................................PLAQQTCANNRH----------QCSVHAECRDYATGFCCRCVANYTG----------------------NGRQCVAEGSPQRVN---KVKGRIFVGSSQVPVVFENTDLHSYVVMN-HGRSYTAISTIPETVGYSLLPLAPIGGIIGWMFAVEQDG-FKNGFSITGGEFTRQAE.......... 139
55 -10.9001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  11  4...............................................................................................................................................................ASNMSSAHKCIDTNVPENAACYRYLGTEEWRCLLGFKGGKCVPASITCEE----NNGGCAPEAECTM----------------------DDKKEVECKCTKEGSEPLF 88
56 -10.9002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  13............................................................................................................................................................................DIPKNAGCFDDDGTKEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENS------------------KKIICTCKEPTPNA.. 88
57 -10.7001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  14  16.............................................................................................................................................................................CLHDGVCIEALDKYACNCVVGYIGERCQ.................................................................. 45
58 -10.6002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  1..............................SDVNECLTACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSC........................................................................................................................................................................... 69
59 -10.6003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  28  16.............................................................................................................................................................................CVNGGECLSNPSRYLCKCPNEFTGDRCQ.................................................................. 48
60 -10.5001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  22  8..........................................................................................................................................................................DGYCLNGGVAIESLDSYTCNCVIGYSGDRCQ.................................................................. 40
61 -10.4001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  14  14.............................................................................................................................................................................CLHDGVCIEALDKYACNCVVGYIGERCQ.................................................................. 43
62 -10.4002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  10  1.................................................................................................................................................................TMSSEHTCIDTNVPDNAACYRYLGTEEWRCLLTFKE----------------------EGGKCVP-ASNVTCKDNNGGCAPEAECKMTDSNKIVCKCTKEGSEPLF 84
63 -10.4002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  13............................................................................................................................................................................DIPKNAGCFDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQ------------------NAESTENSKKIICTCKEPTPNAYY 90
64 -10.3003b4v_C mol:protein length:237 follistatin-like 3  ali model follow..  2...................................GSGNPAPGGVCLQQGQEATCSLVLQ-RAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCGVECGPGKACRMLGGRPRCECALPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVDQTGSAHCVVCRAAPCPVPSSPGQEL-----CGNNNVTYISSCH--MRQATCFLGRSIGVRHAGSC.................... 217
65 -10.3001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  9..........................................................................................................................................................................KKQCPQNSGCFRHLEREECKCLLNYKGDKC---VENPNPTCNENNGGCDADAKCT------------------EEDSGSNGKKITCECTKPDSYPLF 87
66 -10.2001z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  16...AVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQ-LCVNYPGGYTCYCKKGFKQKSCE........................................................................................................................................................................................................ 84
67 -10.1001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  7........................................................................................................................................................................CIDTNVPENAACYRLDGTEEWRCLLYFKE----------------------DAGKCVP-APNMTCKDKNGGCAPEAECKMNDKNEIVCKCTKEGSEPLF 83
68 -9.9703cfw_A mol:protein length:164 L-selectin  ali model follow..  86................................................................................................................................NKEDCEIYIKRNKDAGKWNDDACHKLKAALC-----YTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQ.................................................................. 154
69 -9.7602p6a_D mol:protein length:315 Follistatin  ali model follow..  10  1...........................................GNCLRQAKNGRCQVLYCSTGSWTEEDVNDNTLFKTCENVDCGPGKKCRMNKKNKPRCVDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEQYLCGNDGVTYSSACH--LRKATCLLGRSKCIKAKSCEDIQCTGGKKCLWDFKVGRCDELCPDSKSDEPVCASDNATYASEC......... 266
70 -9.7203asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  11  147............................................................................................................................KEGFQG--CLASVDLNGRLPDLISDALFCNGQIERGCEGPST-TCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEA....................... 264
71 -9.7001k7t_A mol:protein length:186 agglutinin isolectin 3  ali model follow..  5......................................EQGSGMECPNN----LCCSQYGYCGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCS-----------QYGHCGFG----AEYCGAGCQGGPCRAD---IKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTD------KPCGKDAGGRVCT------NNYCCSKWGSCGIGGYCGAGCQSGGCDGVFAEAIATNSTLLA.................. 185
72 -9.5803i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model follow..  1..................................................GEEACECQEDAGNKVCSLQ---------CNNHACGDGGDCSLNF------------NDPWKNCTQS-----LQCWKYFSDGHCDSQ---------CNSAGCLDGFDCQRAGQCNPLYDQYCKDHFSDGHCDQGCNSAEC----EWDGLDCAEHV............................................................... 121
73 -9.4604zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  19RGDQRCDRECNSPGCGW------------------------DGGDCSLSVGDPWRQCEALQ----CWRLFNNSRCDPACSSPACLDNFDCHAGRTCNPVYEKYCADHFADGRCDQGCNTEEC----GWDGLDCASEV---------PALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQYHRPSPGSEPRARRELAPEVIGS-IDNRLCLQSPENDHCFPDAQSAAD......................... 232
74 -9.3903eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  1..........GEEACELPECQEDAGNKVCSLQCNNHACG--DGGDCSLNFNTQSLQCWKYFSDGHCDSQ---------CNSAGCLDGFDCQRAGQCNPLYDQYCKDHFSDGHCDQGCNSAEC----EWDGLDCAEHVLMPPEQLRNSSFHFLRE---LSRVLHTNVVFKRDAHGQQMIFPYYGMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAA................................................... 210
75 -9.3204ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  28............................................DCVKASD--QCL-----KEQSCSTKYRTLRQCVAGKETNFSLTSGLEAKDECRSAMEALKQKSLYNCRCKRGMKK-EKNCLQSLQGNDLLEDSPYEPVNSRLSDIFRAVPFISVEHISKGNNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRRFCSCRDIACTERRRQTIVPVCSYEERERPNCLSLQDSCKTNYICRSRLADFFTNCQPESRSVSN 271

FFAS is supported by the NIH grant R01-GM087218-01
1 1 5 0 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.