current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst SMMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAAAEIGPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGRGGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDALFARYENRPRGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNWMSLast
1 -109.0004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model  100  1SMMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAAAEIGPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGRGGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDALFARYENRPRGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNWMS 259
2 -107.0001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  81  2....RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEIGPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFADYENLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS 256
3 -103.0003wye_A mol:protein length:256 Diacetyl reductase [(S)-acetoin forming], L-2  ali model follow..  38  2.......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEIGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGHGGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQTAARDLAPLGITVNGYCPGIVGTGMWEQIDAELSKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASPDSDYMTGQSLLIDGGMVFN 256
4 -103.0001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  38  2.......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEIGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN 256
5 -103.0003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  37  5....SLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGTKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMAEITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVFR 262
6 -102.0003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  33  5AGIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGLENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIWEAELRGMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD 263
7 -101.0003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  37  2.......SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLQEEQAAETIKLIDQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGVKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAELSKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLYN 258
8 -94.3004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  35  2AMTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDDALDATAREVGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGR-GRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKTDGESVEQSWQRHQLTLIPQGRAQTPEDMGRLALFFATM--DNVTGQAVNVDGGFTFH 260
9 -90.9004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  29  4QLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV-----------PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM. 261
10 -90.8003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  34  1..TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKAS----------PHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH 247
11 -90.6002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  30  1.MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV-----------PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFMA 258
12 -90.5001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  31  1.MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-YGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG.... 262
13 -90.0004npc_A mol:protein length:265 Sorbitol dehydrogenase  ali model follow..  37  15....PLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISADIAKAKAEELGENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGNGGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGKYGICVNTLSPTIVLTELGKKA-----------AGEKGEAAKKRIPAGRFAYPEEIAAAAVFLASAGADMITGADLLIDGGYTI. 258
14 -89.9004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  31  2....KLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARLGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQ-GKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTV-----------PDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL. 246
15 -89.4004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  29  2AMGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVIGRSAEKGRAQAAGLGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIQREYHG----APANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWGA 260
16 -89.2003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  33  7..PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAG-GGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATV-----------TPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE 254
17 -89.1005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  30  1..MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVG-GGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAALEN-----------TDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFALG 252
18 -88.3004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  35  1.MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEA-VEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQ-GKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEV-----------PEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM. 244
19 -88.0004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  35  8RRPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYE--EPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTG---------YSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSA. 260
20 -88.0003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  22  4SMGGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVPSKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEE--SKGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEHQAGKYGTSVEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCGEYKA 264
21 -87.9003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  5..MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIAS-GSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENG-----------EEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL. 253
22 -87.8001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  30  8....RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNG-GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSV-----------TPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE 253
23 -87.7004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  31  2....STDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEEAGAALIAEIGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAA-KYGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQM-----------PERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVVG 256
24 -87.6002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  33  1..MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEA----GGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVG-GGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIA-----LSPDPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTAS 248
25 -87.4004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  31  14..MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLEEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDA-KKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGN-----------PPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY... 260
26 -87.0001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  28  1.MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEK---------FADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL. 252
27 -86.9002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  36  2.....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYANEQKANEVVDEIGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQ-RHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLD-----------ENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM. 246
28 -86.8003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  17..MQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG--------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAG-GGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTG----FAKRGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAVA 260
29 -86.8003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  38  4..SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRG-GGAIVNQSSTAAWLY---SNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEAN----------RTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII. 251
30 -86.8001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  28  1.MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEK---------FADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ. 252
31 -86.6003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  27  2GMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEK---------FADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK. 254
32 -86.5002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  30  2....QLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSASTSLDATAEEFGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQ-KSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLP-----------DKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM. 247
33 -86.3001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  28  15..MATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKA-MLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN. 274
34 -86.3003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  30  6....SLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEIGDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGKPQNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGAKCVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPL-------LTTFMGEDSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSIG 257
35 -86.2003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  36  2.....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYASKEKAEAVVEEIGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQ-RSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALS-----------DELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM. 246
36 -86.2003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  30  2.....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYASKKAALETAEEIGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNG-GGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNR---------EDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL. 248
37 -85.9004jro_A mol:protein length:271 FabG protein  ali model follow..  37  18..AMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNSPEAAEETAKLVGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQ-RAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLD-----------EKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM. 265
38 -85.9004e4y_A mol:protein length:244 Short chain dehydrogenase family protein  ali model follow..  22  1....SNAMANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQSFS------AENLKFIKADLTKQQDITNVLDII--KNVSFDGIFLNAGILIKGSIFDIDIESIKKVLDLNVWSSIYFIKGLENNL---KVGASIVFNGSDQCFIAKPNSFAYTLSKGAIAQMTKSLALDLAKYQIRVNTVCPGTVDTDLYRNLIQKYANNVGISFDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDKSKFMTGGLIPIDGGYTAQ 244
39 -85.8003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  29  18...GLLKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLLGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKT----------SSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQR... 265
40 -85.6003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  31  28KVMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTAS-GRGRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMG-----------EEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVL. 278
41 -85.6003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  36  23....DLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPLA------------DYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC. 269
42 -85.6004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  25  13YFQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHDAAGAQETLNAIGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEE------------SALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML.. 261
43 -85.6003sju_A mol:protein length:279 Keto reductase  ali model follow..  28  16.....SRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRA-MREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVREGYARHWGVTEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGN. 272
44 -85.6004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  32  1..MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGD------LTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTN-GYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTV-----------PQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL. 240
45 -85.5005f1p_A mol:protein length:265 PtmO8  ali model follow..  37  2NAVGRLEGKIAIVTGAASGIGAVTAERLAAEGARVALADLDAVGVQTLAEKIGTHAIGIEVDLADPASVRAMVAAAVEEFGGLDILHNNAAATADVPVADADPEVWDRTMRVNLSGAMVATQAALPHLIARG-GGCVINTSSAAGLSGDLSHPAYAASKAALISLTRSVATQAGRSGVRCNAIAPGLIITRPER--------------EAAYRVMLPHHLTTRLGRPEDVASAVVFLASDEASFITGQTLVVDGGLLAH 254
46 -85.5003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  30  5..MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRR-RNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLN-----------EKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM. 248
47 -85.5001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  33  2....RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAV--GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREK-NPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKV-----------PEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTIG 241
48 -85.3004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  30  14RLRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEA-RRGWIVNTSSVAGKTYSPVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGV-----------APEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYMA 267
49 -85.3004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  32  15.QSMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEIGSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNG-GGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFA-----EAKDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSIG 266
50 -85.2004iuy_A mol:protein length:274 Short chain dehydrogenase/reductase  ali model follow..  28  18....DVKDKYILITGASSGLGHHIAELFAKEGANIVICARRLERLKELESHIGVQVYTFALDVNDRSAVKDMLSSLEAEGVTIDVLINNAGVSDTKRFLDYNDEDWDKIVDTNLKAPWQCAQEVVQHMIKAERKGSIINITSILSQSTNLGVSPYCASKAGLRHLTEVMAVELARFGINVNAIAPGYMITEINEEY-----------TSEVGQQLLKKIPTRKFVEFDDLNGPLLLLASQAGQGITGIEIKVDGGHSAA 266
51 -85.2003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  25  2.KPYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRA-DAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRREAREERELDWAQWTAQLARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGGLSR. 263
52 -84.9001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  27  1.......SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYASAKAAEEVSKQIGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKK-RKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLG-----------EDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI. 244
53 -84.8003woh_A mol:protein length:251 SiaM  ali model follow..  33  4TGPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVDDSSAKETQGEIGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRK-RSGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDS-------------KRLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM. 251
54 -84.7003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  28  14GSMFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADLGKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRR-RYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLN-----------EKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM. 259
55 -84.6005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  30  2..MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKA--AKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQ---------LNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA 251
56 -84.6004qec_A mol:protein length:248 ElxO  ali model follow..  27  2.......KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVS-CGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEID--------SGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ 248
57 -84.6003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  30  3..MIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDNYTIEVCNLANKEECSNLI----SKTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQK-RYGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLN-----------EKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM. 242
58 -84.5003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  27  1.MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKADETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAGQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQ-----------DVRDRISNGIPMGRFGTAEEMAPAFLFFASHLSGYITGQVLDINGGQYKH 258
59 -84.5004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  27  18..AMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRNAEVADALKNELGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKS-RFGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLK-----------DELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM. 265
60 -84.4004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  27  1.MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHDPANIDETIASMGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAGQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQ-----------DVRDRISNGIPMGRFGTAEEMAPAFLFFASHLSGYITGQVLDINGGQYKH 258
61 -84.4004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  35  1.MAMRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFSDHGQQLARAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQG-GGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNIP-----------DDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGGYTAQ 248
62 -84.3003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  23  2........STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELE---AFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKR-KSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYF---YPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM. 245
63 -84.3003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  34  18..HPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERG-GGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMFDG----ALGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTI.. 267
64 -84.2002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  31  1..MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLE---EGGSLVLTGSVAGL-GAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGL-----------PPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV 242
65 -84.2001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  26  11....SFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDK-----------KIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI. 264
66 -84.2002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  28  7ERRKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRG-GGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVL----------MDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTAS. 258
67 -84.2004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  28  1.MFSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASGTTSAVISTGSIAAREGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKS-----------DELKTRIANSIPMGRFGTVQELAPAYVFFASHASGYITGQILDVNGGQIC. 257
68 -84.1002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  36  1.MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNG-WGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLQ---------AIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH 249
69 -84.1004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  34  3..MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASKAGADAVVSAIGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGE---GASIINISSVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHS--------AGIIGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDDARWMTGEHLVVSGGL... 249
70 -84.1001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  22  2........STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELE---AFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKR-KSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYF---YPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM. 245
71 -84.0004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  30  3..TQDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGEGRVLNSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQ-RAGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRAL-----------PEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLMP 248
72 -84.0004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  29  1.MFSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHDPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASGTTSAVISTGSIAAREGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKS-----------DELKTRIANSIPMGRFGTVQELAPAYVFFASHASGYITGQILDVNGGQIC. 257
73 -84.0004cql_B mol:protein length:244 CARBONYL REDUCTASE FAMILY MEMBER 4  ali model follow..  28  1.....MMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQ-QGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKE--------------EHLKKNIPLGRFGETIEVAHAVVFLLE--SPYITGHVLVVDGGLQLI 237
74 -83.9003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  29  8TRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRG-GGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRML----------MDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGT... 257
75 -83.8003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  33  5SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKK-RQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALN-----------DEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM. 250

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.