current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4cbz_A mol:protein length:312 PROTEIN JAGGED-1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVDLast
1 -87.3004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model  100  1SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD 306
2 -57.2002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  95  3...............................................................................................................................................GSGSIEGRSAVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEI.. 163
3 -53.2004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  36  2SSIFQLRLQEFANERGMLANGRPCEPG------------CRTFFRICLKHYQAT-FSEGPCTFGNVSTPVLGTN---SFVIRDKNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPETSPIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNECIPHKGCRHGTCTIPWQCACDEGWGGLFCDQAAA....................................... 261
4 -50.2004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  40  2SGVFELKLQEFVNKKGLLGNRNCCRGGA-----GPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVL--GVDSFSLPDGGGADSAFSNPIRFPFGFTALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDL-HSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELG. 308
5 -41.9004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  37  3SSIFQLRLQEFANERGMLANGRPCEPG------------CRTFFRICLKHYQAT-FSEGPCTFGNVSTPVLGTNSFVIRDNSGSGRNPLQLPLNFTWPGTFSLNIQAWHTPGDDLRPESLISQIIIQGSLAVGKNWKSDEQNNTLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQPDGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECNCRPGWQGPLCNEAA....................................................................... 230
6 -41.0002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  19  51...............VNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVV------QVGFPCLGKQDGVAAF----------EVDVIVMNSEGNTILKTPQNAIFFKTCQ---QAECPGGCRNGGFCNE---RRICECPDGFHGPHCEKALCTPRCMNGGL-CVTPGFCICPPGFYGVNCDKANCSTT-CFNGGTCFYPGKCICPPGLEGEQCEISKPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPV----CEPGCGAHGTCHEPN----KCQCQEGWHGRHCNKR. 309
7 -35.4004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  10  49........................................................................................................................................IKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNGSSAPWHPGGTWV------------IGCRVNQQVVALDISGDQGATLATYAGEGPIGFKSQQADGGSSAPWHNGGVWVMTYAGEGPIGFKGNSVAGNNYAVETSAPWHPGGIWLLHGSMTYSGEGPIGFRAMALP... 278
8 -34.9005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  1.....................................................................................................................................................................QDPCASNPCANGGQCLPASYICHCPPSFHGPTCRQDVEKPGLCRHGGTCHNSYRCVCRATHTGPNCEPCSPSPCQNGGTCRPTHECACLPGFTGQNCEENIDDC-PGNNCKNGGACVD-GVNTYNCRCPPEWTGQYCT... 153
9 -34.8005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  5......................................................................................................................................................................DPCASNPCANGGQCLPASYICHCPPSFHGPTCRQDVQKPGLCRHGGTCHNSYRCVCRATHTGPNCEPCSPSPCQNGGTCRPTHECACLPGFTGQNCEENIDDC-PGNNCKNGGACVD-GVNTYNCRCPPEWTGQYCT... 156
10 -33.0004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  1.......................MAAYLVQNQWGGSQATWNPGGLGARDKQNVVAL-DIKSDDGGKT--LKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSAPWQPGGV---------WVLGARDKQNIVAVSIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDGSAAPWHSGGVWV------------LGTRGKQNVNVDAKSNDGGKTLSTYNGEGPIGFRGTLTSTVENQWGGSTAPWNPGGFWM--IGARNGQNVVALNVA-----SSDGGKTLA-GTMIYNGEGPIGFRAR...... 265
11 -31.9004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  30  1........................................................................................................................................................................................................DICDPNPCENGGICLPSFSCECPDGFTDPNCSPCTPNPCHNGGTCEIGYVCKCPRGFNGIHCQHNINECEV-EPCKNGGICTD-LVANYSCECPGEFMGRNCQYK. 134
12 -29.9001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  11  1...............................................................................................................................EEMKKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYDQCETSPCQNQGKCKDGEYTCTCLEGFEGKNCELFTCSLDNGDCDQFCHESVVCSCARGYTLAACIPTGPYPCGKQTLERRKAQATSSSGEAPDSITWKPYDAADLDPTENPFDLLDFN-QTQPERGDNNLTRIVGGQ.. 194
13 -29.7004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  26  189...........................................................................................................................................................CEAQKWGPECNHLC--TACMNNGVCHEDTGECICPPGFMGRTCEKA--------------------CELHTFGRTCKECSQEGCKSYVFCLDPYGCSCATGWKGLQCNEACHDCKLRCSCNNGEMCDRFQ----GCLCSPGWQGLQCERE. 321
14 -29.6004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  26  1....................................................................................................................................................................................................DVDECALGANPCEHAGKCLNSFECQCLQGYTGPRCEECISNPCQNDATCLDEFQCICMPGYEGVYCEINTDECAS-SPCLHNGRCVD-KINEFLCQCPKGFSGHLCQSG. 117
15 -29.2002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  25  3...................................................................................................................................................................................................QDVDECSLGANPCEHAGKCINSFECQCLQGYTGPRCEECVSNPCQNDATCLDEFQCICMPGYEGVHCEVNTDECAS-SPCLHNGRCLD-KINEFQCECPTGFTGHLCQVD. 120
16 -28.9001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  16  2......................................................................................................................................................................................NSFLEEMKKGHLERECMEETCSYEEAREVFEDSDEFWNKYKDG------DQCETSPCQNQGKCKDEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHE-EQNSVVCSCARGYTLADNGKA. 123
17 -28.4001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  20  2......................................................................................................................................................................................NAFLEELRPGSLERECKEEQCSFEEAREIF-------KDAERTKLFWISDQCASSPCQNGGSCKDSYICFCLPAFEGRNCETHKDDQ-LICVNENGGYCSDHTGTKRSCRCHEGYSLLADGVS. 126
18 -27.2002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  27  1...................................................................................................................................................................SARGGGGHDALKGPNV-CGSRYNAYCCPGWKGNQCIVPICRHSC--GDGFCSRPNMCTCPSGQIAPSCGSRSIQHCCMNGGSCSDDHCLCQKGYIGTHCGQPV----CESGCLNGGRCVAPN----RCACTYGFTGPQCE... 136
19 -25.8001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  16  1................................................................................................................................................................................................YNSGKLEEFVNLERECIEEKCSFEEVFENTEKTNEFWKQDQCEPNPCLNGGLCKDSYECWCQVGFEGKNCELDATCNIKNGRCKQF--CKTGADSKVLCSCTTGYRLAPDQKS. 123
20 -22.5001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  22  1........................................................................................................................................................................................................................SYQVICRDEKTQMIYQQSWLRPVLRSNRV---EYCWCNSGRAQ-CHSVPVKSC-SEPRCFNGGTCQQAYFSDFVCQCPEGFAGKSCEID. 87
21 -22.1001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  20  1.............................................................................................................................................................................................SKHVDGDQCLVEHPCASLCCGHGTCIDSFSCDCRSGWEGRFCQNCSLDNGGCTHYCLEWRRCSCAPGYKLGDDLLQCHPAV-KFPCGRPWKRME....................... 108
22 -21.4001fax_L mol:protein length:96 FACTOR XA  ali model follow..  20  5.......................................................................................................................................................................................................................................DQCETSPCQNQGKCKDEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHE-EQASVVCSCARGYTLADNGKA. 80
23 -21.1002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  18  76..............................................................................................................................................................................................................RSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQFEVDVIVMNSEGNTILKTPQNAQQAECPGGCRNGGFCNERR----ICECPDGFHGPHCEGTK 182
24 -21.0001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  27  1......................................................................................................................................................................................................................ANSFLEEVKQGNLEREC--------LEEACSLEEVFEDAEQTDEFWSKYKDGDQCEG-HPCLNQGHCKD-GIGDYTCTCAEGFEGKNCEF.. 83
25 -20.2004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  22  7.......................................................................................................................................................................................................................................EPQLLRFFHKNEIWYRAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVE-GHRLCHCPVGYTGPFCDVD. 82
26 -19.5001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  16  5...................................................................................................................................SAVTVDTICKNGQLVQMSNHFKCMCNEGLVENTCEEK-------------------ECKKETLGKACEFGQCIENPDPAQ---VNMYKCGCIEGYTTCVLDVCQYKNCGESGECIQSAGCSCAIGKVEKKCTKTGETACQLKCNTDNEVCKNV-EGVYKCQCMEGFTKNVC.... 177
27 -18.3005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  20  122........................................................................................................................................................DSFCSNGVTHRDCDGVQINVPITFQVKV--TATECIQEQSFVIRRCRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCEDNNSIICSGLGDCVCG-QCLCHTSIYGQYCECDTINCERYNGGPGRGLCF-------KCRCHPGFEGSACQ... 313
28 -18.0004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  13  305...........................................................................................................................................................AEDDTNAFYCMKTAASSNMVYVTSHTRPDHETKCPPREKGKYCKPNARASLSNATAEQCGQLSSADGSSLSSQVRGYTFVATDCNMGESCAATARGKCFFYSTVPECLIHSPTTMASVDCGAHGTC---DVATGKCVCEPGFTGERCDAA. 503
29 -17.5002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  15  121.......................................................................................................................................................YDSFCSNGVTHRNQPTECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCE------CQTQGRSSQELEGSCRKDNNSIICS-------------GLGDCV-------QCLCHTSIYGQYCE... 274
30 -17.2002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  22  6............................................................................................................................................................................................................ARWCPQDSSCVNATACRCNPGFSSNECATLSKVSCGKFSDCWNSYDCVCSPGYEENTCQDVDECSSGQHQCDSSTVCFNT-VGSYSCRCRPGWKPRVCE... 143
31 -16.8005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  23  412..............................................................................................................................................TDIVTVQVLPQCECRCRDQSRDRSL-CHGK----GFLEC---GICRCDTGYIGKNCERKDNNSIICSGLGDCV--GQCLCHTSIYGQYCENCERYNGPGRGLCFCG-KCRCHPGFEGSACQCERTTEGCLNPCSGRGRCR-------VCECHSGYQLPLCQ... 591
32 -15.8003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  18  9...........................................................................................................................................................CQEDAGNKVCSLQC-----------------NNHACGWDGGDCSLNFNDP-------WKNCTQSLQCWKYFSDGHCDQCNSAGCLFDG-------FDCQRAEGQCNPLYD----QYCKDHFSDGHCDQG-----CNSAECEWDGLDCA... 117
33 -15.7001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  15  4...................................................................................................................................NECLDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTR------SGNCYLDIRPRGDNGDTACSNEI---------GVGVSKASCCCSLG----KAWGTPCEMCPAVNTSEYKILCPGGEGFRTVILE-DIDECQELPGLCQGGKCINT-FGSFQCRCPTGYYTRVCD... 162
34 -15.7002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  17  5......................................................................................................................................................................DECESSPCINGVKNSPGSFICECSSESTLD------------PTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSQVDPICGKGYSGTQCE-DIDECEVFPGVCKNGLCVNT-RGSFKCQCPSGMTGRIC.... 146
35 -15.6004aqs_A mol:protein length:525 LAMININ SUBUNIT BETA-1  ali model follow..  27  280........................................................................................................................................................HCMCRHNTKGLNCELACKKCNCNEHSSSCHSGGVCNCQHNTMGRNCEQNLCEPCTCDPAGSENGAGQCRCKLHVEGERCDVCKEGYGCKSCACNETGYCYCKRLVTGQRCDQGCRPCDCDLGGALNNSCSEDS----QCSCLPHMIGRQCN... 524
36 -15.5001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  20  11.......................................................................................................................................................................................................................................HKCIDTNVPENAACYRTEEWRCLLGFKGGKCVPASITCEENNGCAPEAECTMDDKKEVECKCTKEGSGVFCSSSS 97
37 -15.4002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  14  20.......................................................................................................................................................................................PPQWRCNDELEPSQCTAA---CKSCREAPGP-FPGKLICEDIYWGADPGPFCTGDCCDKAFCNKMNPPTCRCMDEVKECADACKDCQRVESSEPP-----------RYVCKDRFTG....... 124
38 -15.4004wnx_A mol:protein length:433 Netrin-4  ali model follow..  19  263........................................................................................................................................................RCMCKHNTAGSHCQH-CAPEAADGRTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCNN-----CQHNTEGQHCQRCKPRPFSAPDACKA---CSCHPV-------------SAILPFSSVTFCDPSN----DCPCKPGVAGPHCD... 403
39 -15.3004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  28  452....................................................................................................................................................................CNCDCQKEVEVNSSKCHHGNGSCACHPGHMGPRCECGEDMLSSCSGRGDCY--GQCICHLSIYGPYCQSCVRHKCGGNGDCDCG-ECVCRSGWTGEYCNCTTSTDSCVSECSGRGDCV-------KCVCNPGASGPTCE... 615
40 -15.2003i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model follow..  12  10...........................................................................................................................................................CQEDAGNKVCSLQCNNHACGWDGGDCSLTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRA-EGQCNPLYDQ------YCKDHFSDGHCDQG--NSAECEWDGLDCAEHV----PERLAAGTLVVV........................ 133
41 -15.1001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  21  2......................................................................................................................................................................................................DPDGCLSNPCFPGAQCSSSWSCFCPVGFLGNHCDECACFSTSKVPRCVNGFHCPCPPRYRGNQPVEPENPCKDKHNCHKHAECIYFSDPMYKCECQTGYAGDGLI... 143
42 -14.7003zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  20  302............................................................................................................................................HATVCVYDNSKLTCECEHNTTGPDCGK---------------------CKKNYQGRPWSPGSYLPIPKGAANACIP-----SISSIGTNVCDN-ELLHCQNGGTCHNNVRCLCPAAYTGILCE----KLR----CEEAGSCGSDS----QGAPPHG.......... 419
43 -14.5001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  18  5.......................................................................................................................................................................................................................................HRCIDTNVPENAACYRTEEWRCLLYFKAGKCPAPNMTCKDKNGCAPEAECKMNDKNEIVCKCTKEGSGVFCS... 89
44 -14.4002oo4_A mol:protein length:234 Neurogenic locus notch homolog protein 2  ali model follow..  17  1..................................................................................................................................................................................................GATCLSQYCADKA--RDGVCDEA--NSHACQWDGGDCSLTMENPCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCSEECGWDGLDCA... 114
45 -14.2004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  25  433....................................................................................................................................................................CDCACQAQAEPNSHRCNNGNGTCRCGPGWLGSQCECSEEDYRPCSQRGECL--GQCVCHSSDFGKSCVRYKGEMCSGHGQCSCG-DCLCDSDWTGYYCNCTTRTDTCMSSCSGRGKCE-------SCVCQPGSYGDTCE... 599
46 -14.1003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  23  130.............................................................................................................................................................................................................GGVAKETYKSLPKLVHAKEGFQG-----CLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTC-QEDSCSNQGVCLQQ--DGFSCDCSTSFSGPLCNDP. 223
47 -14.1002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  22  6.......................................................................................................................................................................................................................................HTCIDTNVPDNAACYRTEEWRCLLTFKGGKCPASNVTCKDNNGCAPEAECKMTDSNKIVCKCTKEGSGVFCS... 90
48 -14.0004urt_A mol:protein length:420 NETRIN-1  ali model follow..  18  265........................................................................................................................................................VCDCRHNTAGPECDR-CKPF--RATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVC-----LNCRHNTAGRHCHYCKEKPITHRKACK---ACDCHPGAAGKTCNQTTG----------------------QCPCKDGVTGITCN... 397
49 -13.9004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  22  412..............................................................................................................................................TDIVTVQVLPQCECR-------CRDQSRDRSLCHGKGFLE--GICRCDTGYIGKNCECQTQGRSSCSGLGDCV--GQCLCHTSIYGQYCE-CDTINCEGRGLCFCG-KCRCHPGFEGSACQCERTTEGCLNPCSGRGRCR-------VCECHSGYQLPLCQ... 591
50 -13.6002ddu_A mol:protein length:387 reelin  ali model follow..  10  122...................................................................................................................................PASAGKGCEGNSRELSEPTVYYTGDFEEWTRITIAIPRSLASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCIS-GVCFCDLGYTAAQGTCVSNTPNHFEGKLSPLW-YKITGGQVGTGCGTLNDGRSLREARTVPLDTRNIRLVQFYIQIGSKTSGITCIKPR 307
51 -13.6001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  28  1..................................................................................................................................................................................................................................................................GTSHLVKCAEKE-KTFCVNGGECFMSNPSRYLCKCQPGFTGARCT... 48
52 -13.4002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  21  6........................................................................................................................................................................................................................DYDIPTTENLYFQGANECLDNNGGCSHVCNDGYECLCPDGFQ-----VAQRRCEDIDECQDPDTCSQNLEGGYKCQCEEGFQTKACK... 101
53 -13.4005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  312........................................................................................................................................................TEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSYDSFCSNGVTHRNQPRGDCDGVPITFQVKVTAT-ECIQEQSFVLPQCESRDRSLCHGKGFLECG-ICRCDTGYIGKNCEPAALQTLFQGPAQGKKKLQALK----KKNAQLKWKLQALK... 498
54 -13.3003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  22  5...................................................................................................................................................................................................DPCFRANCEYQCQPLN---QTSYLCVCAEGFAPIPHEPHRCQLFCNQTACPTQASCECPEGYIGFICT-DIDECENGGFCSG--VCHNL-PGTFECICGPDSA........ 109
55 -13.2004ove_A mol:protein length:437 Netrin-1  ali model follow..  18  281........................................................................................................................................................VCDCRHNTAGPECDR-CKPF--RATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLN-----CRHNTAGRHCHYCKEKPITHRKACKA---CDCHPGAAGKTCNQTTG----------------------QCPCKDGVTGITCN... 413
56 -12.8001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  22  6........................................................................................................................................................................................................................................QCVKKQCPQNSGCFEREECKCLLNYKGDKCENPNPTCNENNGCDADAKCTEEDGKKITCECTKPDSGIFCSSSN 96
57 -12.7004plm_A mol:protein length:432 Netrin-1  ali model follow..  19  280........................................................................................................................................................VCDCKHNTAGPECDR-CKPF--RATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLN-----CRHNTAGRHCHYCKEKPISHRKACK---ECDCHPGAAGQTCNQTTG----------------------QCPCKDGVTGITCN... 412
58 -12.6001wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  18  2..........................................................................................................................................................RCGEQGSNMECPN----------NLCCSQYGYCYCGKGCQNGACWTSKR-CGSQAGGATCTNN-QCCSQYGYCGFGAEYCGAGCCSQWGFCGLG-SEFCGGGCQSGACSTD-RVCTNNYCCSKWGSC-----GIGPGYCGAGCQSGGCD... 170
59 -12.6001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  20  3......................................................................................................................................................................................................PVDPCFRANCEY--QCQPSYLCVCAEGFAPIPHEPHRCQMFCNQTACPTQASCECPEGYIGFICT-DIDECENGGFCSG--VCHNL-PGTFECICGPDSAGTDC.... 118
60 -12.5004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  40  1....................................................................................................................................................................................................................................................................MDIVDGDQCES-NPCLNGGSCKD-DINSYECWCPFGFEGKNCELLE 44
61 -12.4003u3p_A mol:protein length:313 Tumor necrosis factor receptor superfamily me  ali model follow..  18  28..........................................................................................................................................................KCPAGTY-EHCLRVCSS--CPVGTFTRHENGIEKCHD------CSQPCPWPMIEKLPCAALTDRECTCPPGMF-QSNATCAPHTVCPVGWGTETEDVRCKQCARGTFSDVSVMKCKAYTDCLSQNLVVITKETDNVCGTLPSFS........ 177
62 -12.3001k7t_A mol:protein length:186 agglutinin isolectin 3  ali model follow..  18  16........................................................................................................................................................LCCSQYGYCGMGCGKGCQNGACWTSK---------RCGSQAGGKTCPNNHC----CSQYGHCGFG-AEYCGAGCQGGPCRAAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNG-RVCTNNYCCSKWGSC-----GIGPGYCGAGCQSGGCD... 170
63 -12.2001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  23  6........................................................................................................................................................................................................................................QCVKKQCPQNSGCFEREECKCLLNYKGDKCENPNPTCNENNGCDADAKCTEEDGKKITCECTKPDSGIFCS... 93
64 -12.1003cfw_A mol:protein length:164 L-selectin  ali model follow..  23  86..................................................................................................................................................................................................................................NKEDCVEIYIKRNKDAGKCHKLKAALCY------------TASCQPWSCSGHGECVEI-INNYTCNCDVGYYGPQCQFV. 156
65 -12.1003eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  16  10...........................................................................................................................................................CQEDAGNKVCSLQC-----------------NNHACGWDGGDCSLNFNDP-------WKNCTQSLQCWKYFSDGHCDQCNSAGCLFDGFDCQRAEGQCNPLYDQ-----------YCKDHFSDGHCDQG------NSAECEWDGLDCA... 118
66 -12.0005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  20  1........................................................................................................................................................................................................................GPAMSCIPGESSDNCTALVQTE--DNPRVAQVSITKCSSDMNG---------------CLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFF 74
67 -11.8004ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  12  25......DRLDCVKASDQCLKEQSCSTK------RTLRQCVAG--KETNFSLTSGLEAKDECR--SAMEALKQKSLYNCRCKRGKKEKNCLRIYWSMYQSLQSPYEPVNSRLSDIFRAVPFISVEHISKGNNCLDAAKACNLDDTCKKYRSAYITPCTTSMSNEVCNRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTEPVCRPNCLSLQDSCKTNYICRSRLADFFTNCQPESRSV----SNCLKENYADCLLAYSGLIGTV-----MTPNYVDSSSLSVAP-----WCDCSSGNDLEDCL... 321
68 -11.8003ltf_D mol:protein length:58 Protein spitz  ali model follow..  24  2................................................................................................................................................................................................................................................................FPTYKCPETFD----AWYCLNDAHCFAADLPVYSCECAIGFMGQRCEYKE 50
69 -11.7002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  15  4..................................................................................................................................................................................................................................PKHVCVD--TRDIPKNAGCFGTEEWRCLLGYKTCVENNNPTCDINNGGCDPTASCQNAESKKIICTCKEPTPGVFCSSSS 99
70 -11.7001npe_B mol:protein length:164 Laminin gamma-1 chain  ali model follow..  20  23.........................................................................................................................................................THCPTGTAGKRCEL-CDDGYFGDPLGSNGPVRLCRCQCNDNIDPNAVGNCNR----LTGECLK-----CIYNTAGFYCDRCKEGFFGNPLAPNPADKCK--------ACA-----CNPYGTVQQQSSCNPVT----QCQCLPHVSGRDCG... 147
71 -11.6001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  34  6.......................................................................................................................................................................................................................................DECKEPDVCKHGQCINSYRCECPFGYAGNEC-VDTDECSVGNPCGN-GTCKNV-IGGFECTCEEGFEMMTCE... 82
72 -11.5001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  34  1....................................................................................................................................................................................................................................................................NSYPGCPSS-YDGYCLNGGVCMHESLDSYTCNCVIGYSGDRCQTRD 46
73 -11.5002wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  18  2...........................................................................................................................................................................................RCGEQGSNMECPNNLC----CSQYGYCGMG-GDYCGKGCQNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYGGKLCPNNLCCSQWGFC-----GLGSEFCGGGCQSGACS... 127
74 -11.4002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  15  4..................................................................................................................................................................................................................................PKHVCVD--TRDIPKNAGCFGTKEWRCLLGYKTCVENNNPTCDINNGGCDPTASCQNANSKKIICTCKEPTPGVFCSSSS 99
75 -11.4001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  30  4.......................................................................................................................................................................................................................................DECRISPDCGRGQCVNDFECKCDEGYMMKNC-MDIDECQRDPLLCRGGVCHNT-EGSYRCECPPGHQISAC.... 85

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.