current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 4bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
2 -28.5004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  21  38.CEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCE-INTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQSGRL. 119
6 -25.5004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  22  48.EPTSAGPCTPNPCHNGGTCEISEIGYVCKCPRGFNGIHCQ-HNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKGGG 137
8 -25.0004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  15  420.CDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCS-APVSRCEHAPCHNGATCHQRGHGYVCECARSYGGPNCQFLLPE 502
9 -25.0001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  12  48......DQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIP 126
14 -23.4004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  12  46........ALNIKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNTYAGGSSAPWHPGGTWVAGTMTYAGEGPIGFKSQQADGGVYA 150
16 -22.3004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  12  39............KSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTGGTSAPWQPGGKTLTGTTTYNGEGPIGFKSEVTDGDTYS 139
18 -20.2004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  22  232......DKCIPHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGDKYQCSCPEGYSGPNCEIV... 305
19 -19.5004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  21  189GKYCDQPICLSGCHEQNGYCSK---PDECNCRPGWQGPLC-----NECIPHKGCRHGTCT---IPWQCACDEGWGGLFCDQAAA. 261
20 -19.2002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  23  91......DKCIPHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGDKYQCSCPEGYSGPNCEI.... 163
21 -19.0003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  25  186.............................................TTCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCNDPGTT 226
22 -18.6001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  23  1..........................................SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKD. 42
23 -18.6004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  34  3.........................................IVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELL... 43
24 -18.0004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  19  158..DSCSRLCKKRDDHFGHY--ECQPDGSPSCLPGWTGKYCDQ---PICLSGCHEQNGYCSK---PDECNCRPGWQGPLCNEAA.. 230
25 -17.6001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  32  1............................................TASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE. 40
26 -17.0001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  27  5.........................................LVKCAEKEKTFCVNGGECLSNPSRYLCKCQPGFTGARCTENVPM 53
27 -15.8003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  27  191.............................................EEGEGGVCLNGGVCSVVDDQAVCDCSTGFRGKDCSQGKEE 231
28 -15.8003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  28  1........................................RYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNE 45
29 -15.6001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  28  3.........................................YPGCPSSYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCQTRD.. 46
30 -15.5005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  27  2.............................................NPCCSHPCQNRGVCMSGFDQYKCDCTTGFYGENCST.... 39
32 -14.9001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  31  30.........................................PAPVNPCCYYPCQHQGICVRFGDRYQCDCTTGYSGPNCTIP... 72
33 -14.8003cfw_A mol:protein length:164 L-selectin  ali model follow..  34  103.................................KWNDDACHKLKAALCYTWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVQVD 159
34 -14.8002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  41  148.............................................QAECPGGCRNGGFCN---ERRICECPDGFHGPHCEGT... 181
35 -14.8001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  34  7.............................................PSSYDGYCLNGGVCIESLDSYTCNCVIGYSGDRCE..... 43
36 -14.1002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  26  69.CGSRSIQHCNIRCMNGGSCSD----DHCLCQKGYIGTHCG----QPVCESGCLNGGRCV---APNRCACTYGFTGPQCE..... 136
37 -13.8003ltf_D mol:protein length:58 Protein spitz  ali model follow..  21  9.............................................ETFDAWYCLNDAHCIADLPVYSCECAIGFMGQRCEYKE.. 50
38 -13.0001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  28  2.......................................PL--AQQTCANNQCSVHAECRDYATGFCCRCVANYTGN........ 39
40 -12.8001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  31  4.............................................PSSYDGYCLNGGVAIESLDSYTCNCVIGYSGDRCQ..... 40
42 -12.4001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  46  16....................................................CLHDGVCIEALDKYACNCVVGYIGERCQ..... 45
43 -12.4003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  42  16....................................................CVNGGECLSNPSRYLCKCPNEFTGDRCQ..... 48
45 -12.1001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  46  14....................................................CLHDGVCIEALDKYACNCVVGYIGERCQ..... 43
46 -12.0005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  18  2......PAMSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIY----LVDMSQNYCRCEVGYTGVRCE..... 71
47 -12.0002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  15  295GAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNV---TSGALLCSQALCSGHGRCVQMAVEFKCRCYPGWQAPWCE..... 411
49 -11.7004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  18  423...............ARGKCFFYSTVPECLIHSPTTMAFTAVLPEDKCVSVDCGAHGTCDV--ATGKCVCEPGFTGERCDAAALV 506
50 -11.6004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  16  196..PECNHLCTA--CMNNGVCHEDTGE--CICPPGFMGRTCEKA--RTCKQEGCKSYVFCLPDPYG--CSCATGWKGLQCNEA... 279
51 -11.6003qh0_A mol:protein length:610 Prostaglandin G/H synthase 2  ali model follow..  27  13.......................................GLSQAANPCCSNPCQNRGECMSTGDQYKCDCTTGFYGENCTTP... 57
53 -11.5002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  16  3...SSEHTCIDTNVPDNAACYRYLDGEEWRCLLTFKGGKCVPASNVTCKDNNCAPEAECKMTSNKIVCKCTKEGSE......... 81
54 -11.4001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  27  40.......................................CLRKYKDFCIHGECKY----VKELRAPSCICHPGYHGERCH..... 76
55 -11.2001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  19  89...CVLDVCQYKNCGESGECLSEIQSAGCSCAIGKVEKKCTKTGETACQLKCNTDNEVCKNVEGVYKCQCMEGFTKNVC...... 177
56 -11.1001g1q_A mol:protein length:162 P-SELECTIN  ali model follow..  27  86NNEDCVEIYIKSPSAPG----------------KWNDEHCLKKKHALCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRDD 159
59 -10.8005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  15  234..GSCRKDNNSIICSGLGDCV-----GQCLCHTSDVPGKLIYGQYCECDTINCPGRGLCFCG----KCRCHPGFEGSACQ..... 313
60 -10.7003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  30  430...........................KCCCSPGWEGDFCRTAKCEP----ACRHGGVCVRPN---KCLCKKGYLGPQCE..... 475
61 -10.5002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  16  186.CRCRDQSRDRSLCHGKGFLE-----GICRCDTGYIGKNCEQELEGSCRKDNCSGLGDCV------QCLCHTSIYGQYCE..... 274
62 -10.5001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  12  1...ADPDGCLSNPCFPGAQCSSFPDGSWGFCPVGFLGNGTHCEDLDECALVSTSKVPRCVNTQPGFHCPCPPRYRGNQPV..... 85
63 -10.5003s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  28  566........................................RVIGSNPCANGGCSH--LCLYRPQGLRCACPIGFEMKTCIVP... 611
64 -10.4002k2s_B mol:protein length:61 Micronemal protein 6  ali model follow..  42  13..............................................ACSSNPCEAAGTCKETNSGYICRCNQGY........... 42
65 -10.2001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  20  15................RGQCVNTPGDFECKCDEGYMMKNCMDIDECQRDPLLCRG-GVCHNTEGSYRCECPPGHQISAC...... 85
66 -10.0001pz7_A mol:protein length:204 Agrin  ali model follow..  1......................................................EKVIIEKAAGDAEAIAFDGRTYMEYHNAVTK 31
67 -9.9705e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  27  184............................CECRC----------RDQSRDRSLCHGKGFLE------ICRCDTGYIGKNCEHH... 223
68 -9.7703s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  30  567........................................KELNLQEYRQHPCQDNGGCSHIDGTTRCSCPMHLVELSC...... 615
69 -9.5601uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  21  1..........................................TDVNECLDPTTCISGNCVNTPGSYICDCPPDFE.......... 33
70 -9.5602w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  24  87.........................QVDPICGKGYKGTQCEDIDECEVFPGVCKN-GLCVNTRGSFKCQCPSGMTGRIC...... 146
71 -9.4401iox_A mol:protein length:50 Betacellulin  ali model follow..  27  8.......................................CPKQYKHYCIKGRCRF----VVAEQTPSCVCDEGYIGARCE..... 44
72 -9.4304a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  30  570........................................KELNLQEYRQHPCQDNGGCSHIDGTTRCSCPMHLVELSCG..... 619
73 -9.4201mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  32  8.......................................CPDSHTQFCFHGTCRF----LVQEDKPACVCHSGYVGARCE..... 44
74 -9.3003s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  30  568........................................KELNLQEYRQHPCADNGGCSHIDGTTRCSCPMHLDELSCG..... 617
75 -9.3002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  17  1GVDPKHVCVDTRDIPKNAGCFDDDGTKEWRCLLGYEGNTCVENNNPTCDINNCDPTASCQNAESTIICTCKEPTPNAYYE..... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.