current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3pme_A mol:protein length:420 Type C neurotoxin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst SINDSKILSLQNKKNALVDTSGYNAEVRLEGDVQVNTIYTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLTNSHNEYTIINSIKQNSGWKLCIRNGNIEWILQDINRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYINGELKQSERIEDLDEVKLDKTIVFGIDENIDENQMLWIRDFNIFSKELSNEDINIVYEGQILRNVIKDYWGNPLKFDTEYYMINYNYIDRYIAPKNNILVLVQYSDISKLYTKNPITIKSAANKNPYSRILNGDDIMFHMLYDSREYMIIRDTDTIYATQGGQCSKNCVYALKLQSNLGNYGIGIFSIKNIVSQNKYCSQIFSSFMKNTMLLADIYKPWRFSFENAYTPVAVTNYETKLLSTSSFWKFISRDPGWVELast
1 -121.0003pme_A mol:protein length:420 Type C neurotoxin  ali model  100  1SINDSKILSLQNKKNALVDTSGYNAEVRLEGDVQVNTIYTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLTNSHNEYTIINSIKQNSGWKLCIRNGNIEWILQDINRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYINGELKQSERIEDLDEVKLDKTIVFGIDENIDENQMLWIRDFNIFSKELSNEDINIVYEGQILRNVIKDYWGNPLKFDTEYYMINYNYIDRYIAPKNNILVLVQYSDISKLYTKNPITIKSAANKNPYSRILNGDDIMFHMLYDSREYMIIRDTDTIYATQGGQCSKNCVYALKLQSNLGNYGIGIFSIKNIVSQNKYCSQIFSSFMKNTMLLADIYKPWRFSFENAYTPVAVTNYETKLLSTSSFWKFISRDPGWVE 414
2 -106.0003obr_A mol:protein length:434 Botulinum neurotoxin type D  ali model follow..  92  8SINDSKILSLQNKKNALVDTSGYNAEVRVGDNVQLNTIYTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLTNSHNEYTIINSIEQNSGWKLCIRNGNIEWILQDVNRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYINGELKQSQKIEDLDEVKLDKTIVFGIDENIDENQMLWIRDFNIFSKELSNEDINIVYEGQILRNVIKDYWGNPLKFDTEYYIINDNYIDRYIAPESNVLVLVQYPDRSKLYTGNPITIKSVSDKNPYSRILNGDNIILHMLYNSRKYMIIRDTDTIYATQGGECSQNCVYALKLQSNLGNYGIGIFSIKNIVSKNKYCSQIFSSFRENTMLLADIYKPWRFSFKNAYTPVAVTNYETKLLSTSSFWKFISRDPGWVE 421
3 -91.4004jra_A mol:protein length:443 Botulinum neurotoxin type A  ali model follow..  28  13NIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNLFNLESSKIEVILKNAIVY--NSMYENFSTSFWIRIPKYFNSISLNYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQ--------AGVEKILSALEIPDVGNLSQVVVMSKNDQGITNKCKMNLQDNNGNDIGFIGFHQF-----NNIAKLVASNWYNRQIETLGCSWEFIPVDDGWGE 434
4 -88.8004kbb_A mol:protein length:459 Botulinum neurotoxin type B  ali model follow..  30  21EILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFKL-TSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNL-NNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYF--------KKEEEKLFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESLIGIHRFYESGIVFEEYKDYFCISKWYLKEVKRKGCNWQFIPKDEGWTE 453
5 -88.3001d0h_A mol:protein length:469 PROTEIN (TETANUS TOXIN HC)  ali model follow..  23  24ILKKSTILNLDINNDIISDISGFNSSVITYPDALVPGINGKAIHLVNNESEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGTNESLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNNQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLPNNEIDSFVKSGDFIKLYVSYNNNEHIVGYPKDG-----NAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDDKNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKGCDWYFVPTDEGWTN 458
6 -88.0002vxr_A mol:protein length:482 BOTULINUM NEUROTOXIN TYPE G  ali model follow..  29  41NISSNAILSLSYRGGRLIDSSGYGATMNVGSDVIFNDIGNGQFKLNNSENNITAHQSKFVVYDSMFDNFSINFWVRTPKYNNNDIQTYTIISCIKNDSGWKVSIKGNRIIWTLIDVNAKSKSIFFEYSIKDNISDYINKWFSITITNDRLGNANIYINGSLKKSEKILNLDRINSSNDIDFKLINCTDTTKFVWIKDFNIFGRELNATEVSSLYWIQSSTNTLKDFWGNPLRYDTQYYLFNQGMQNIYIKYFSKASMGTNFNNAAINYQNLYLGLRFIIKKASNSRNINNDNIVREGDYIYLNIDNISDESYRVYVLVNSKEIQTQLFLAPINDDPTFYDVLQIKKYYEKTTYNCQILCEKDTKT-FGIGKFVKDYGYVWDTYDNYFCISQWYLRRISEGCNWQFIPVDEGWTE 474
7 -87.9002vu9_A mol:protein length:444 BOTULINUM NEUROTOXIN A HEAVY CHAIN  ali model follow..  29  13SHMDTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNLFNLESSKIEVILKNAIVY--NSMYENFSTSFWIRIPKYFNSISLNYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQA-------GVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFH-----QFNNIAKLVASNWYNRQIERSGCSWEFIPVDDGWGE 434
8 -87.6003r4s_A mol:protein length:443 Botulinum neurotoxin type C1  ali model follow..  36  7NINDSKILSLQNRKNTLVDTSGYNAEVSEEGDVLNPIFPFDFKLGSSGEDRGKVTQNENIVYNSMYESFSISFWIRINKWVSNLP-GYTIIDSVKNNSGWSIGIISNFLVFTLKQNEDSEQSINFSYD-ISNNAPGYNKWFFVTVTNNMMGNMKIYINGKLIDTIKVKELTGINFSKTITFEINKSDSDNINMWIRDFYIFAKELDGKDINILFNSLQYTNVVKDYWGNDLRYNKEYYMVNIDYLNRYMYANSRQIVFNTRRNNNDFNEGYKIIIKRIRGNTNDTRVRGGDILYFDMTINNKAYNLFMKNETMYADNHSTEDIYAIGLREQTKDINDNII--FQIQPMNNTYYYASQIFNGENISGICSIGTYGGDWYRHNYLVPTVKQGNYASLLESTSTHWGFVPVSEPGS. 434
9 -85.2004isq_A mol:protein length:431 Neurotoxin  ali model follow..  37  4SINDSKILSLQNKKNTLMDTSGYNAEVRVEGNVLNPIFPFDFKLGSSGDDKVIVTQNENIVYNAMYESFSISFWIRINKWVSNLP-GYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQDINFSYDISKN-AAGYNKWFFVTITTNMMGNMMIYINGKLIDTIKVKELTGINFSKTITFQMNKSDSDNINMWIRDFYIFAKELDDKDINILFNSLQYTNVVKDYWGNDLRYDKEYYMINVNYMNRYMSKKGNGIVFNTRKNNNDFNEGYKIIIKRIRGNTNDTRVRGENVLYFNTTIDNKQYSLGMYKPSR-----NLGTDLVPLGALDQPMDEIRKYGSFIIQPCNTFDYYASQLFLSSNATRLGILSIGSDYWFNHEYLIPVIKIEHYASLLESTSTHWVFVPAS..... 425
10 -84.8003fuq_A mol:protein length:417 BoNT/F (Neurotoxin type F)  ali model follow..  26  4KIKDNSILDMRYENNKFIDISGYGSNISINGDVIYSTNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNQKLVFNYTQMISISDYINKWIFVTITNNRLGNSRIYINGNLIDEKSISNLGDIHVSDNILFKIVGC-NDTRYVGIRYFKVFDTELGKTEIETLYSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQNSNFLNINNIFSNTRLYTGVEVIIRKNGSSNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKLIRTS-----------NSNNSLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKN-----TSSNGCFWSFISKEHGWQE 416
11 -81.5001fv2_A mol:protein length:472 TETANUS TOXIN HEAVY CHAIN  ali model follow..  23  31ILKKSTILNLDINNDIISDISGFNSSVITYPDALVPGINGKAIHLVNNESSVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGTNESLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNNQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLPNNEIDSFVKSGDFIKLYVSYNNNEHIVGYPKDG-----NAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDDKNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKGCDWYFVPTDEGWTN 465
12 -80.7003azv_A mol:protein length:443 D/C mosaic neurotoxin  ali model follow..  36  13SINDSKILSLQNKKNTLMDTSGYNAEVRVEGNVLNPIFPFDFKLGSSGDDKVIVTQNENIVYNAMYESFSISFWIRINKWVSNLP-GYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQDINFSYD-ISKNAAGYNKWFFVTITTNMMGNMMIYINGKLIDTIKVKELTGINFSKTITFQMNKSDSDNINMWIRDFYIFAKELDDKDINILFNSLQYTNVVKDYWGNDLRYDKEYYMINVNYMNRYMSKKGNGIVFNTRKNNNDFNEGYKIIIKRIRGNTNDTRVRGENVLYFNTTIDNKQYSLGMYKPSR-----NLGTDLVPLGALDQPMDEIRKYGSFIIQPCNTFDYYASQLFLNATTNRLGILSIGSDYWFNHEYLIPVIKIEHYASLLESTSTHWVFVPASE---E 437
13 -56.8004qvs_A mol:protein length:227 S-layer domain-containing protein  ali model follow..  15  2..NAETGAWYMFDTNEFKDYKGNHGNAVLYSANVVPGLNGNSVSLDGVDDYVALPDG----IAGTFYNFTIAFWVRLDT-IGEQPIFDFFDSGSNNKYMRLTAESDGKIKFAMTQSGYY-----GEKTITSGSALTEGVWKHVAVTLSG-DTGTLYINGENVGENNTLSLRPLTETSKGYIGKSHQTNSYLHGMIDDFRIFDRALSADEIKTLASVATRVN................................................................................................................................................................................................. 227
14 -53.3003ffz_A mol:protein length:1252 Botulinum neurotoxin type E  ali model follow..  25  846RIKSSSVLNMRYKNDKYVDTSGYDSNININGDVKYPTNKNQFGIYNDKLSEVNISQNDYIIYDNKYKNFSISFWVRIPNYDNKIVNVNNINCMRDNNSGWKVSLNHNEIIWTLQDNAGINQKLAFNYGNANGISDYINKWIFVTITNDRLGDSKLYINGNLIDQKSILNLGNIHVSDNILFKIVNC-SYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNILKDFWGNYLLYDKEYYLLNVLKPNNFIDRRKDSTLSINNIRSTILLANRLYS-RVNNSSTNDNLVRKNDQVYINFVASKTHLFPLYADTATTNKEKTIKISSS-------------GNRFNQVVVMNSVGNNCTMNFKNNNGNNIGLLGFKADTVVASTWYYTHMRDHT-----NSNGCFWNFISEEHGWQE 1251
15 -51.9003v0c_A mol:protein length:1312 BoNT/A  ali model follow..  28  872NIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKNSSLYRGAKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIP-------DVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFH-----QFNNIAKLVASNWYNRQIERSGCSWEFIPVDDGWGE 1293
16 -49.2004zkt_A mol:protein length:1252 Bontoxilysin A  ali model follow..  27  846RIKSSSVLNMRYKNDKYVDTSGYDSNININGDVKYPTNKNQFGIYNDKLSEVNISQNDYIIYDNKYKNFSISFWVRIPNYDNKIVNVNNINCMRDNNSGWKVSLNHNEIIWTLQDNAGINQKLAFNYGNANGISDYINKWIFVTITNDRLGDSKLYINGNLIDQKSILNLGNIHVSDNILFKIVNC-SYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNILKDFWGNYLLYDKEYYLLNVLKPNNFIDRRKDSTLSINNIRSNRLYSGIKVKIQRVNNSSTNDNLVRKNDQVYINFVASKTHLFPLYADTATTNKEKTI------------KISSSGNRFNQVVVMNSVGNNCTMNFKNNNGNNIGLLGFKADTVVASTWY-----YTHMRDHTNSNGCFWNFISEEHGWQE 1251
17 -46.5001epw_A mol:protein length:1290 BOTULINUM NEUROTOXIN TYPE B  ali model follow..  30  858EILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFKLTSSANSKIRVTQNQNII-FNSVFLDFSVSFWIRIPKYKNDGIQNYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNL-NNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSNQNSKYINYRDLYIGEKFIIRRKSNSQNDDIVRKEDYIYLDFFNLNQEWRVYTYKYFK--------KEEEKLFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGYESGIVFEEYKDYFCISKWYLKEVKRGCNWQFIPKDEGWTE 1290
18 -45.6004c1w_A mol:protein length:188 NEURAMINIDASE  ali model follow..  15  1..............................GAMVIEK--EDVETNASNGQRVDLSSELDKL--KKLENATVHMEFKPDAKAPAFYNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGKQFY---NNYNDAPLKVKPGQWNSVTFTVEKKGRVRLYVNGVLSRTSLRSGNKDMPDVTHVQIGAANNTVWGSNLQIRNLTVYNRALTPEEVQKR......................................................................................................................................................................................................... 187
19 -44.6002v73_A mol:protein length:191 PUTATIVE EXO-ALPHA-SIALIDASE  ali model follow..  1..........................GMASKGEVDEIANYGNLKITKEEERVNITGD--LEKFSSLEEGTIVTRFNMND--TSIQSLIGLSDGNKANNYFSLYVSGGKVGYELRRQEGNGD----FNVHHSADVTFNRGINTLALKIEKGIGAKIFLNGSLVKTVSDPNILNAINLNSGFIGANGYNEYLFRGNIDFMNIYDKPVSDNYLLRKTGETK.................................................................................................................................................................................................... 191
20 -38.1003v0a_B mol:protein length:1196 NTNH  ali model follow..  16  834ETWPYELVLYAFKNNVIGDASGKNTSIEYSKDILVYGINSDALYLNGSNQSISFSNDFFE--NGLTNSFSIYFWLRNLGKDTIKS---KLIGSKEDNCGWEIYFQDTGLVFNMIDSNG-------NEKNIYLSDVSNNSWHYITISVDRKEQLLIFIDDNLVANESIKEILNIYSSNIISLL-----SENNPSYIEGLTILNKPTTSQEVLSNYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDISEDNRQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNNDMSKYLYL---------------------------------WSFKP....... 1196
21 -35.6004zkt_B mol:protein length:1163 Botulinum neurotoxin type E, nontoxic-nonhema  ali model follow..  16  799..SPYELSLYAFQNNVIGDTSGKNTLVEYPKDILVYGINNNAIHLTGANQNIKFTNDYFE--NGLTNNFSIYFWLRNLKQNTIKS---KLIGSKEDNCGWEIYFENDGLVFNIIDSNG-------NEKNIYLSNISNNSWHYIVISINRLKQLLIFIDNILVANEDIKEILNIYSSDIISLL-----SDNNNVYIEGLSVLNKTINSNEILTDYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHD.................................................. 1150
22 -33.6003vuo_A mol:protein length:1196 NTNHA  ali model follow..  13  831MLSPYQLLLFATRSNIIEDISGKNTLIQYTESVLVYGVNGESLYLKSPNETVEFSNNFFT--NGLTNNFTICFWLRFTGKDDDKT---RLIGNKVNNCGWEIYFEDNGLVFEIIDSNG-------NQESVYLSNVINNNWYYISISVDRKDQLLIFINDKNVANVSIEQILNIYSTNVISLV-----NKNNSIYVEELSVLDKPVASEEVIRNYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISPENNRLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGA............................................. 1189
23 -26.2004dqa_A mol:protein length:355 uncharacterized protein  ali model follow..  12  114...............RVHSSSVSTLSGTNIAYFFFSKPLKITKAGNFSNHYISVKFPVGTFF----SSFTYEALINVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDY-----------LEVAGGQNYRVTKPLLTNRWYHVALTYDQTGKTGIYVNGEKWAGSDWGDGFDPNSDMGFYIGRFKWGERPFHGKMSEVRVWSVARTENQLKQ.......................................................................................................................................................................................................... 300
24 -26.0003zyp_A mol:protein length:218 CIP1  ali model follow..  12  5..........DFESGWDQTDCNQGGTVSLDTTVAHSG--SNSMKVVGGPNGYC-GHIFFGTTQVPTGDVYVRAWIRLQTALGSNHVTFIIMPDTAQGGKHLRIGGQSQVLDYNRESDDATLPDLSPNGIASTVTLPTGAFQCFEYHLGTDGTIETWLNGSLIPGMTVGPGVDNPNDTGVNFGWEAYSGDVNTVWFDDISIASTRVG................................................................................................................................................................................................................ 216
25 -23.4004pbp_A mol:protein length:210 C-reactive protein  ali model follow..  2................................EFFKNLSGKVLQFATDNSYVKLYPEKPLSL----SAFTLCMRVATELPLDREVILFAYYTPDVDEL-NVWRERDGRVSLYIQSS---------KDAAFFRLPPLSTLQTHLCVAWESTGLTAFWMDGRRSLHQVYRKGYSIRSGGTVVLGQDPDSDQSFVGEIANLQMWDYVLSSAQIKAVYYN...................................................................................................................................................................................................... 181
26 -22.6001b09_A mol:protein length:206 PROTEIN (C-REACTIVE PROTEIN)  ali model follow..  10  2...................................TDMSRKAFVFESDTSYVSLKAPLTKPL----KAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVG-----------GSEILFEVPEVTVAPVHICTSWESSGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSSQSLVGDIGNVNMWDFVLSPDEINTIYLG...................................................................................................................................................................................................... 177
27 -20.6003flp_A mol:protein length:217 SAP-like pentraxin  ali model follow..  14  1..................................AVDIRDVKISFTQNPKFPHLRFMQTL---PAVRQLTVCQRIKPFHRNTGYIFSCATSNQDNQFITSMYVKSDGTLNLGLQVNASS------NKYISCPIEIELGQWYHVCHVWSGDGRMAVYANGSPCGTENVGKGHQISAGGTVVIGQEQDKQESWSGELSDLQVWDEALTTHQVSTVASCNG.................................................................................................................................................................................................... 186
28 -20.6001gyk_A mol:protein length:204 SERUM AMYLOID P-COMPONENT  ali model follow..  13  2...................................TDLSGKVFVFESVTDHVNLITPLEKPL----QNFTLCFRAYSDLSRAYSLFSYNTQGRDNE-------------LLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSSQSFVGEIGDLYMWDSVLPPENILSAYQG...................................................................................................................................................................................................... 175
29 -17.9001za4_A mol:protein length:251 Thrombospondin 1  ali model follow..  12............GDNSVFDIELTGAARKGSGRRLVKGPDPSAFRIEDANLIPPVPDDDLVDAVRTEKGFLLLASLRQMK--KTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQ----HVVSVEEALLATGQWKSITLFVQE-DRAQLYIDCEKMENAELDVPIQSVFTRDLASIAKGGVNDNFQGVLQNVRF...................................................................................................................................................................................................................... 203
30 -16.0004xun_A mol:protein length:181 Endo-1,4-beta-xylanase C  ali model follow..  12  11..AGQALFKADFEDGNIGNWRARG-TEKLEVVSGIGHNSNRSLKTSSRSETYHGPLVEVLPYLQKGSTVHISFWAMYDEGPATQVINGSLEKEFNRDTA------------------------NLEYAMFASTTLNKGQWKKIEADITGISGLRMYAETPWKQSSEVTETDTIP-------------------YVDDVQITATEAIAIE............................................................................................................................................................................................................. 180
31 -16.0003mw3_A mol:protein length:208 Neurexin-2-beta  ali model follow..  1....................................GPGSTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGF-----STHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDD------ITIDEPNAIVSDGKYHVVRFTRSG-GNATLQVDSWPVNERYPAGNFDARQRIPYRLGGGRDQGRPFQGQVSGLYY-----NGLKVLALAAESDPN.................................................................................................................................................................................................. 198
32 -15.6002r1d_A mol:protein length:226 Neurexin-1-beta  ali model follow..  14  38.......................................GTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF-----STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGLTIFNSQATIIIG-GKEQGQPFQGQLSGLYYNGLKVLN............................................................................................................................................................................................................... 194
33 -15.5003bop_A mol:protein length:175 beta-Neurexin 2D4  ali model follow..  12  1.......................................ATTYIFGKGGALITYTWPPNDRPSTRMDRLAVGF-----STHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDD------ITIDEPNAIVSDGKYHVVRFTRSG-GNATLQVDSWPVNERYPAGLTIFNSQAAIKIG-GRDQGRPFQGQVSGLYYNGLKVLA............................................................................................................................................................................................................... 157
34 -15.5003mw2_A mol:protein length:207 Neurexin-1-alpha  ali model follow..  10  3.......................................GSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF-----STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGNNDARQRIPYRLGGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDANIAI............................................................................................................................................................................................... 200
35 -15.1003biw_E mol:protein length:243 Neurexin-1-beta  ali model follow..  12  52.......................................GTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF-----STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIA------IEESNAIINDGKYHVVRFTRSG-GNATLQVDSVIERYPAGRQLTIFNSQATIIIG-GKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDAN.................................................................................................................................................................................................. 216
36 -15.1002r1b_A mol:protein length:220 Neurexin-1-beta  ali model follow..  10  1..............................GSSLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF-----STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGNNDARQRIPYRLGGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDAN.................................................................................................................................................................................................. 204
37 -15.0003b3q_E mol:protein length:197 NRXN1 protein  ali model follow..  14  14.........................................TYIFSKGGGQITYKWPPNDRPSTRADRLAIGF-----STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSVIERYPAGRQLTIFNSQATIIIG-GKEQGQPFQGQLSGLYYNGLKVLN............................................................................................................................................................................................................... 168
38 -14.8003vkf_C mol:protein length:181 Neurexin-1-beta  ali model follow..  13  2......................................SGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF-----STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWIERYPAGRQLTIFNSQATIIIG-GKEQGQPFQGQLSGLYYNGLKVLN............................................................................................................................................................................................................... 159
39 -14.7001qu0_A mol:protein length:191 LAMININ ALPHA2 CHAIN  ali model follow..  9........................................SGTYFDGTG-FAKAVGGFKV-----GLDLLVEFEFRTTRPTG-----VLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFT---AIYDAEIPGHMCNGQWHKVTAKKIK-NRLELVVDGNQVDASPNSASTSADTNDPVFVGFGLTTNIRFRGCIRSLKLTKGTGKPLEVN........................................................................................................................................................................................................... 173
40 -14.7002r16_A mol:protein length:182 Neurexin-1-alpha  ali model follow..  1...................................GSREATVLSYDG-SMFMKIQLPVV----MHTEAEDVSLRFRSQRAYG----ILMATTSRDSADTLRLELDAGRVKLTVNLGKG-------PETLFAGYNLNDNEWHTVRVVRRG-KSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGYLSSVPSNFIGHLQSLTFNGMAYID............................................................................................................................................................................................................... 161
41 -14.4003mw4_A mol:protein length:178 Neurexin-2-beta  ali model follow..  13  1....................................GPGSATYIFGKSGGLILYTWPANDRPSTRSDRLAVGF-----STTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVD------ISIKEERTPVNDGKYHVVRFTRNG-ANATLQVDNVNEHYPTGRQLTIFNTQAQIAIG-GKDKGRLFQGQLSGLYYDGLKVLN............................................................................................................................................................................................................... 160
42 -14.3003bod_A mol:protein length:178 Neurexin-1-alpha  ali model follow..  14  6.........................................TYIFSKGGGQITYKWPPNDRPSTRADRLAIGF-----STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWIERYPAGRQLTIFNSQATIIIG-GKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVR............................................................................................................................................................................................... 176
43 -14.1002h0b_A mol:protein length:184 Neurexin-1-alpha  ali model follow..  12  7.........................................IATFKG-SEYFCYDLSQN---PIQSSSDEITLSFKTLQRNG------LMLHTGKSADYVNLALKNGAVSLVINLGSGAFEAL----VEPVNGKFNDNAWHDVKVTRNL-RQVTISVDGILTTTGYTQEDYTLGSDDFFYVGPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKI................................................................................................................................................................................................ 181
44 -14.1001pz7_A mol:protein length:204 Agrin  ali model follow..  11  1............EKVIIEKAAGDAEAIAFDGRTYMEYHNAVTKSPDA-LDYPAEPSEKA------LQSNHFELSIKTEATQG---LILWSGKGLERSDYIALAIVDGFVQMMYDLGSK-------PVVLRSTVPINTNHWTHIKAYRVQ-REGSLQVGNEPITGSSPLGATQLDTDGALWLGLPKAYSTGFIGCIRDVIVDRQELHLVE............................................................................................................................................................................................................. 190
45 -14.0004b1m_A mol:protein length:185 LEVANASE  ali model follow..  11  2..............GSSGHIEGRHMTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAE----YKTPIDVNKKYHLKTEAEG-DRFKIYLDDRLVIDAH---------DSVFSEGQFGLNVWDATAVFQNVTK...................................................................................................................................................................................................................... 173
46 -13.6003sh4_A mol:protein length:195 LG3 peptide  ali model follow..  7.........................................GAYFHD-DGFLAFP-GHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVGEAGQGKDFSLGLQDGHLVFRYQLGSG-------EARLVSEDPINDGEWHRVTALREG-RRGSIQVDGELVSGRSPGPNVAVNAKGSVYIGTGGRFSSGITGCVKNLVLHSARPGAPP............................................................................................................................................................................................................. 174
47 -13.5001q56_A mol:protein length:195 Agrin  ali model follow..  10  14.......................................AEAIAFDG-RTYMEYH-NAVTKSEKALQSNHFELSIKTEATQG---LILWSGKGLERSDYIALAIVDGFVQMMYDLGSK-------PVVLRSTVPINTNHWTHIKAYRVQ-REGSLQVGNEPITGSSPLGATQLDTDGALWLGLPKAYSTGFIGCIRDVIVDRQELHLVE............................................................................................................................................................................................................. 181
48 -13.5001d2s_A mol:protein length:170 SEX HORMONE-BINDING GLOBULIN  ali model follow..  12  12.............................................QEPIAVMTFDLTK-------ITKTSSSFEVRTWDPEG----VIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWA-------QLTVGAGPRLDDGRWHQVEVKMEG-DSVLLEVDGEEVLRLRQVSG---HPIMRIALGLRLPLVPALDGCLRRDSWLDKQAEISASAP.......................................................................................................................................................................................................... 164
49 -13.3002uur_A mol:protein length:245 COLLAGEN ALPHA-1(IX) CHAIN  ali model follow..  10  30..........DLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSS--LFDSQWHKIMIGVER-SSATLFVDCNRIESLPIKPRGPIDIDGFAVLGK-DNPQVSVPFELQWMLIHDPLRPRRE............................................................................................................................................................................................................. 227
50 -13.3001pz8_A mol:protein length:201 Agrin  ali model follow..  11  1............EKVIIEKAAGDAEAIAFDGRTY--------MEYHNAVTKSHLSNEIPAEKALQSNHFELSI-----KTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSK-------PVVLRSTVPINTNHWTHIKAYRVQ-REGSLQVGNEPITGSSPLGATQLDTDGALWLGLPKAYSTGFIGCIRDVIVDRQELHLVE............................................................................................................................................................................................................. 187
51 -13.3003v64_A mol:protein length:191 Low-density lipoprotein receptor-related prot  ali model follow..  3........................................ETLAFDG-RTYIEYLNAVEIPAEKALQSNHFELSLRTEATQG---LVLWIGKAAERADYMALAIVDGHLQLSYDLGSQ-------PVVLRSTVKVNTNRWLRIRAHREH-REGSLQVGNEAPVTGSSPLGATLDTDGALWLGLPKAYGTGFVGCLRDVVVGHRQLHLLE............................................................................................................................................................................................................. 177
52 -13.1003pve_A mol:protein length:189 Agrin, Agrin protein  ali model follow..  13...........................................DFNG-FSYLELKGLHTFE-RDLGEKMALEMVFLARGPSG---LLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKG-------AAIIRSKEPIALGTWVRVFLERNG-RKGALQVGDGRVLGESPVPHTMLNLKEPLYVGRGAAVASGFDGAIQLVSLRGHQLLTQE............................................................................................................................................................................................................. 176
53 -13.0004azz_A mol:protein length:172 LEVANASE  ali model follow..  11  5...........FMSN-MTGWTTVNGTWADTIEGKQGRSDGDSFILSSAS-----------------SDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAE----YKTPIDVNKKYHLKTEAEG-DRFKIYLDDRLVIDAH---------DSVFSEGQFGLNVWDATAVFQNVTK...................................................................................................................................................................................................................... 162
54 -12.9001f5f_A mol:protein length:205 SEX HORMONE-BINDING GLOBULIN  ali model follow..  12  37.................................................................ITKTSSSFEVRTWDPEG----VIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWA-------QLTVGAGPRLDDGRWHQVEVKMEG-DSVLLEVDGEEVLRLRQVSTSKRHPIMRIALGLRLPLVPALDGCLRRDSWLDKQAEISASAP.......................................................................................................................................................................................................... 182
55 -12.3002zzj_A mol:protein length:238 Glucuronan lyase A  ali model follow..  3..........SFYNDGHLNRKENQGTVSEVSNVVFKGTSALKMTQTYTPGYTGRYHSEVDHNRGYQRGYGFAFRLSEDWQFQPQSYNIAQFIANRPGAGTMIWIQNNQLYSRYVNGHYRQPNCGRNIVTPNLATVSAGAWHRVVLASDNTGYFKIWFDGAKVEEYNVATTVDDDSVFQFRVGLYANSWHDDGHMYDEVAV---GTTFADVD........................................................................................................................................................................................................... 234
56 -11.7001h6y_A mol:protein length:170 ENDO-1,4-BETA-XYLANASE Y  ali model follow..  10  6..ANGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKG--SESLLVRNTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQ--------------------------RYDTIDMKTVGPNQWVHLYNPQSDATDMYVYVATADDTIN----------------------------YIDEAIGAVAGTVIEG............................................................................................................................................................................................................. 162
57 -11.7001oq1_A mol:protein length:223 Protein yesU  ali model follow..  7..EGACLYRNPLRSKSDVKMEGGGQISFDDHSLHLSH--------VQDEAHFVFWCPETF-----PDGIIVTWDFSPIEQPGLCMLFFAAAGIRGEDTGTYPEYHSGDIN-TCNLRKSRGFHLAAMGADPLPSPDDADSPYRMKLIKDK-GYVHFSINGLPILEWMDDGSTYGPVLTKGKIGFRQMAPM--KAVYRDFAVHQ--AVRR.............................................................................................................................................................................................................. 223
58 -11.6001h6x_A mol:protein length:170 ENDO-1,4-BETA-XYLANASE Y  ali model follow..  10  6..ANGYYYHDTFEGSVGQWTAAGPAEVLLSGRTAYKG--SESLLVRNTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQ--------------------------RYDTIDMKTVGPNQWVHLYNPQSDATDMYVYVETADDTIN----------------------------YIDEAIGAVAGTVIEG............................................................................................................................................................................................................. 162
59 -11.3001sli_A mol:protein length:679 INTRAMOLECULAR TRANS-SIALIDASE  ali model follow..  11  1.IPEGIL--MEKNNVDIAEGQGY-----------------------------SLDQEAGAKYVKAMTQGTIILSYKSTSENGIQSLFSVGNSTAGNDRHFHIYINSGGIGIELRNTDGVFNYTLDRPASVRALYKGERVFNTVALKADANKQCRLFANGELLATLDKDAISDITGVDNVTLGGTKRQGKPFGGTIGDIKVYSNALSDEELIQATGVTTYGENI............................................................................................................................................................................................... 200
60 -11.2001dyo_A mol:protein length:160 ENDO-1,4-BETA-XYLANASE Y  ali model follow..  10  6..DAGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKG--SESLLVRNTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQ--------------------------RYDTIDMKTVGPNQWVHLYNPQSDATDMYVYVETADDTIN----------------------------YIDEAIG---AVAGTVI............................................................................................................................................................................................................ 160
61 -11.1002zew_A mol:protein length:147 S-layer associated multidomain endoglucanase  ali model follow..  4..MVNMVSNPGFEDGLDS--QDWQQDMSAVPEAAHNG--ALGLKIGGGKADIPLKPNT---------TYILGAWAKFDSKPAGTFDVVVQYHLKDAN----------------------------NTYVQHILNFNETDWTYKQLLFTTPD----------------------VFGSTPQLALWKGDTSKANLYVDDVYL-------VEV............................................................................................................................................................................................................ 147
62 -11.0002zez_A mol:protein length:144 S-layer associated multidomain endoglucanase  ali model follow..  2...SNLIVNGTAENG-MDGWPDWGYPVSAVPEAAYGG--TKGFKLSGGKQ----AGMGQKVALKPNTTYILGAWGKFTAKPGTYCDVIVQYHLKDAN----------------------------NTYVQNILRFTETDWTYKQVVFAFGSDPEFVLWKDDASNADF--------------------------YADNITL-------VEV............................................................................................................................................................................................................ 144
63 -11.0003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  11  808...IGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRIADPVTFKTKSSYVALATLQA------YTSMHLFFQFKTTSLDG-----LILYNSGDGNDFIVVELVKGYLHYVFDLGNGAN-----LIKGSSNKPLNDNQWHNVMISRDT-SNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKEKEGFQGCLASVDLNGRLPDLISDALFCNGQIERG................................................................................................................................................................................................. 1021
64 -11.0003s5q_A mol:protein length:214 Putative glycosylhydrolase  ali model follow..  11  2.............GSDKIENLYFQGYRPLFDKDLSNADYDSS-VWTFKNGILTATADQSIWTKVQYENFILDLEFKTDVNTNSGVVIYCTDKGNWIPSSIEIQIADDHHPEWQSYPEYWRCGSIYGHKGANEQLVKPGEWNRMIITAKG-QQIDIELNGKHIVSANLADWTSGTTNPDGT--PIPYANMPTKGYIGESNIWFRNIQLKQL............................................................................................................................................................................................................ 208
65 -10.9003imm_A mol:protein length:201 Putative secreted glycosylhydrolase  ali model follow..  10  12...............................GKNLENANYNPEVWSETDGVLGAVKDESIWTKDEYENFELDLDFKTDVGTNSGVVVYCTDTKDWIPNSVEIQIADDHCEKWGNGKPYEKCGAIYGHLGAVQDKVKPGEWNHMRIKCAG-QHIMVILNGKKVTEMDMSKWTSGTKNPDGSWLPKPFAELPTKGFIGDSLIWFRNIKIRSL............................................................................................................................................................................................................ 201
66 -10.8001urx_A mol:protein length:282 BETA-AGARASE A  ali model follow..  31..........SFNYTSSEGNR-APQAWTNGSQLAIQAQPAGNGKSYNSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQSIDIMEGY--GSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHNQATNIIIDCENQTDWRPWVDWIRVYKPVAVSLE............................................................................................................................................................................................................. 276
67 -10.7003wz1_A mol:protein length:282 Agarase  ali model follow..  28..........DFNYEAPAAGKSTRFYERWKEGFINPWTGPGLTEWHPHYSYVSITSKAPLTYPVYMEVLASDFWFLSADSTEEIDVIEAYGSDRPGQEWYAERLHLSHHVFIRDPFQDYQPTDAGSWYADGKGTKWRDAFHRVGVYWRDPWHLEYYVDGKLVRTVSGQDIIDPNGFTGAIINMEDQNWRSDNGYVDWVRFYKPVPINGNAT........................................................................................................................................................................................................... 282
68 -10.7001dyk_A mol:protein length:394 LAMININ ALPHA 2 CHAIN  ali model follow..  35.......................................SKQFGLSRNS-HIAIAFDDT----KVKNRLTIELEVRTEAESG----LLFYMARINHADFATVQLRNGFPYFSYDLGSG-------DTSTMIPTKINDGQWHKIKIVRVK-QEGILYVDDASSQTISPKKADILDVVGILYVGRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGT-----------------------FANAESGTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPVFVG.............................................. 339
69 -10.7004yz1_A mol:protein length:677 Putative neuraminidase  ali model follow..  12  21........................................NNVTLTGGGENV----TKELKDKFTSGDFTVVIKYNQSSEKGLQALFGISNSKPGQNSYVDVFLDNGELGMEARDTSSNKNNLVSRPASVWGKYKQEAVTNTVAVVADSVKTYSLYANGTKVVEKKVDNIKDIKGIDYYMLGGVKRAGKTFNGTLENIKFFNSALDEETVKKMTTNAVTGHLI............................................................................................................................................................................................... 208
70 -10.6003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  6........................................DPVTFKTKSSYVALAT-------QAYTSMHLFFQFKTTSLDG-----LILYNSGDGNDFIVVELVKGYLHYVFDLGNGAN-----LIKGSSNKPLNDNQWHNVMISRDT-SNLHTVKIDTKITTQITAGARNLDLKSDLYIGKLVHAKEGFQGCLASVDLNGRLPDLISDAL.......................................................................................................................................................................................................... 171
71 -10.5002c24_A mol:protein length:206 ENDOGLUCANASE  ali model follow..  16  22...........FKDSPVVGLETIGDTLPVDTTVTYNGLPTLRLNVQTTVQLLTLRGWNTHDLSQYVENGYLEFDIKGKEGGED------------------------VIGFRDKVYERVYGLEIDVTTVISNYVTVTTDWQHVKI--------------PLRDLMKINNGFDPSSVTCLVFSKRYADPFTV--WFSDIKITSEDNEKSA............................................................................................................................................................................................................. 194
72 -10.5001mr5_A mol:protein length:648 trans-sialidase  ali model follow..  11  423.TTVGLVGFLSATKTEWEDA---CVNASTANAERVP----NGLKFAGVGGGALWPQGQNQRYHFANHAFTLVASVTIHEVPKGASPLLGASLDSSGGKKLLGLSYDKRHQWQPIYGSTPVT--------------PTGSWYHVVLTMA-NKIGSVYIDGEPLEGSGQTVVPDERTPSHFYVGGYKRMPTDSRVTVNNVLLYNRQLNAEEIRTLFLSQDL................................................................................................................................................................................................... 634
73 -10.4002a75_A mol:protein length:652 sialidase  ali model follow..  424.PTAGLVGFLSANGSVWEDV---CVDANVANAERVP----NGLKFNGVGGGAVWPQGQTRRYQFANYRFTLVATVTIDELPKGTSPLLGAGLEGPGDAKLLGLSYDKNRQWRPLYGAAPAS--------------PTGSWYHVVLTMAD-RQGSVYVDGQPLAGSGNTVVRGATLPSHFYIGGPRSAPTDSRVTVTNVVLYNRRLNSSEIRTLFLSQDM................................................................................................................................................................................................... 635
74 -10.3004xup_A mol:protein length:334 Endo-1,4-beta-xylanase C  ali model follow..  7..AGDILLSHSFEEGTTQGWTARG-GVKVDVTAEQAYQGKQSLQTTGRTEAWNGPSLSLTDVVHKNEVVEISGYVKLVAGSAPADLKFTVERRDGNGDT-------------------------QYDQVNAAEQVTDQKWVKLQGQYEQGSSLLLYLESTDAKAA----------------------------LLDEFQIRLVKAAPEN............................................................................................................................................................................................................. 162
75 -10.3001o4y_A mol:protein length:288 beta-agarase A  ali model follow..  31..........SFNYTSSEGNR-APQAWTNGSQLAIQAQPAGNGKSYNSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQEIDIMEGY--GSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHNQATNIIIDCENQTDWRPWVDWIRVYKPVAVSGGGNNSLE....................................................................................................................................................................................................... 282

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.