current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst GPGSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPESLDAIATLast
1 -114.0003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model  100  1GPGSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPESLDAIAT 262
2 -105.0003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  72  27.RKVMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGRGRVILTSSITGPVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVLPESPDAV.. 285
3 -98.1002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  36  2.......LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVG-VTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM......... 246
4 -97.8002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  29  1.....MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAG-IIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM......... 247
5 -97.5004jro_A mol:protein length:271 FabG protein  ali model follow..  35  15.QSNAMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVG-LIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM......... 265
6 -97.4004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  33  1.....MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARL-AATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVG-LYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL......... 246
7 -97.2003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  2.......SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVG-AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM......... 246
8 -96.0004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  27  15.QSNAMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNVASIIG-ERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM......... 265
9 -96.0004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  31  16....RPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVAGKTYSPIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYM......... 266
10 -95.9004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  34  3.SQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVG-KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM......... 261
11 -95.7001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  35  1.........SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVG-LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI......... 244
12 -95.6004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  1.....MSTDKRVAIITGAANGIGRATALEFAQAGYHV-VAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKYGRILNASSVVG-LYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVV......... 255
13 -95.4002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  34  2....QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVG-KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFMAENL..... 261
14 -95.3004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  28  11.FQGMNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTG-IFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY........... 260
15 -95.0004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  37  2....MSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEA-----AGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTG-TYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM......... 244
16 -94.4003woh_A mol:protein length:251 SiaM  ali model follow..  30  4..TGPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKRSGSIINISSVSG-VFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDS--KRLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM......... 251
17 -94.1004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  34  1....MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGD----------LTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVG-VFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL......... 240
18 -94.1003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  34  1GPGSMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL----GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVG-VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM......... 248
19 -93.8004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  33  2...STQDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGG---EGRVLNSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQRAGRIINITSVVG-VMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLMP........ 248
20 -93.7001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  29  1.....MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAV------GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVY--LGNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTIGAAPA.... 245
21 -93.6002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  34  3.....IKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVG-FTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM........... 247
22 -93.4004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  30  2....FSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQICP........ 258
23 -93.0004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  29  2....FSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQICP........ 258
24 -92.6003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  29  2....FPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYK......... 257
25 -92.5003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  30  1.....MSLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVG-SAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM......... 246
26 -92.4003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  27  3.....MVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNG-QKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM......... 249
27 -92.3003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  33  6...SPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLK-SEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAG-ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQ......... 253
28 -92.3003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  25  3.....LGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGQGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV......... 253
29 -92.2004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  28  2....FPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYK......... 257
30 -92.1002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  33  2..........RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVAVGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVG-ILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTP......... 244
31 -92.0003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  26  2...RGSGSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNG-QKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM......... 250
32 -91.9003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  37  5..AGIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGL----ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTGVIVNTASLAA-KVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQERTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRM......... 262
33 -91.8004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  34  1....MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAG-MMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNAE---PILQFIPLARYGQPEEVAGTIRFLATDPAAYITGQTFNVDGGMVM......... 246
34 -91.7003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  34  13.PGSMFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL----GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVG-VVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLNEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM......... 259
35 -91.7003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  26  1......MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGS-IRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL......... 248
36 -91.4003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  29  2...AMIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNAL----KDNYTIEVCNLANKEECSNLI----SKTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVG-IAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM......... 242
37 -91.3005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  26  1....MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARS-EELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGS-VVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFALGT....... 253
38 -91.3004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  31  15....QSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARGGRIITLSSVSG-VMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESAL-KEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML.......... 261
39 -91.3002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  31  29....YYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVG-LTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS.......... 274
40 -91.2004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  31  15...QSMSLQGKVALVTGASRGIGQAIALELGRLGAVV-IGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVG-AMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYM......... 262
41 -90.9003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  33  16...MDKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVG-SAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM......... 263
42 -90.9004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  27  17.....GAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNG-QKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM......... 263
43 -90.9003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  28  2...SLQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKG--GAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTFTPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVLFSEG...... 253
44 -90.8001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  30  6.PGFTISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLKQQKGSIVVTSSMSSQIIGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI......... 264
45 -90.7003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  32  2..PGSMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADIN-AEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTAA----WLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII......... 251
46 -90.7004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  29  1.....MAMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGWGRIVNISSVNG-SKGSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILDTILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQHM......... 248
47 -90.5004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  32  4.....LGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATDGG-----------NTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYERKAGSIVAISSISG-ERGNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPVASYVTGEVLRVNGAH........... 238
48 -90.3003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  32  5..SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVI----GTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVG-TMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM......... 250
49 -90.1004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  35  14.HMTALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQRSGRIINIASVVG-EMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAAE---KLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVM......... 262
50 -89.9001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  33  1.....MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI----GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGRGGKIINMASQAG-RRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWM......... 255
51 -89.8005cdy_A mol:protein length:244 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  30  1.....MSFEGKIALVTGASRGIGRAIAELLVERGACVI----GTATSEKGAEAISAYLGENGKGLMLNVVDPTSIDTVLATIRAEFGEVDILVNNAGITRDNLLMRMKDDEWQDIIDTNLTSVFRLSKAVMRAMMKKRFGRIITIGSVVG-TMGNAGQVNYAAAKAGVIGFSKSLAREVASRGITVNVVAPGFIETDMTRTLTDDQRAGILAQVPANRLGDAKEIASAVAFLASDEASYISGETLHVNGGMYM......... 243
52 -89.8001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  30  5...DNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDIN-ADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAA-ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ......... 252
53 -89.7001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  32  1.....MNFEGKIALVTGASRGIGRAIAETLAARGAKVI----GTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVG-TMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM......... 243
54 -89.5004yqy_A mol:protein length:270 Putative Dehydrogenase  ali model follow..  30  15...QSMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEG--SSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPK-IRVNSLCPGMIDTDFHNIFKPEVRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLF......... 263
55 -89.4003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  28  15.....SMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNG-SRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM......... 262
56 -89.0004kms_A mol:protein length:249 Acetoacetyl-CoA reductase  ali model follow..  32  1......MAMSEIAIVTGGTRGIGKATALELKNKGLTVVANFFSNYDAAKEMEEKYG-----IKTKCWNVADFEECRQAVKEIEEEFKKVSILVNNAGITKDKMLHRMSHQDWNDVINVNLNSCFNMSSSVMEQMRNQDYGRIVNISSINA-QAGQVGQTNYSAAKAGIIGFTKALARETASKNITVNCIAPGYIATEMVGAVPEDVLAKIINSIPKKRLGQPEEIARAVAFLVDENAGFITGETISINGGHNM......... 242
57 -88.9004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  26  4....GGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDREGAIVNVSSMSS-MGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWG......... 259
58 -88.7003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  32  2.....ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI----GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAKAGRVISIASNTF-FAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVR......... 246
59 -88.5001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  34  4......DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHE-KIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL......... 252
60 -88.2004yxf_A mol:protein length:257 MupS  ali model follow..  29  13.HDSAPSAVKGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSERA-----DFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINA-LRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDMVKDLSPQTLSRIERRTPLGRLGTQQEVADLILYLVDR-GTFVTGQNIAVDGGFTC......... 257
61 -88.2001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  33  4......DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHE-KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ......... 252
62 -88.1004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  37  2..AMTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLL-DDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAG-KEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKRHQLTLIPQGRAQTPEDMGRLALFFATMD--NVTGQAVNVDGGFTF......... 259
63 -88.1002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  29  1....MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE-------AIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQG-LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTA......... 247
64 -88.0004cql_B mol:protein length:244 CARBONYL REDUCTASE FAMILY MEMBER 4  ali model follow..  30  1.......MMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDL----GGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVG-LKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEE---HLKKNIPLGRFGETIEVAHAVVFLLE--SPYITGHVLVVDGGLQL......... 236
65 -88.0003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  22  2..........STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELE-------AFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAP-FGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERFPGMP. 253
66 -88.0003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  30  4....YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHE-MIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK......... 254
67 -88.0001uzl_A mol:protein length:247 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE  ali model follow..  33  7.EGAKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK------------GLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSG-SWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGM......... 245
68 -87.9004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  34  3....MKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAAAEI----GPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQRGGKIINMASQAG-RRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNWM......... 258
69 -87.8001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  27  3.....KKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASV-REKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAG-VKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG............ 262
70 -87.7003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  16...SMQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG------------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWG-LRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV......... 259
71 -87.6002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  35  1....MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAAL----EAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVL--EEGGSLVLTGSVAG--LGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI......... 241
72 -87.6001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  22  2..........STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELE-------AFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATP-FGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGM.. 252
73 -87.5002nm0_A mol:protein length:253 Probable 3-oxacyl-(Acyl-carrier-protein) redu  ali model follow..  37  9...VPRSHMSRSVLVTGGNRGIGLAIARAFADAGDKVAITYRSGEPPE------------GFLAVKCDITDTEQVEQAYKEIEETHGPVEVLIANAGVTKDQLLMRMSEEDFTSVVETNLTGTFRVVKRANRAMLRAKKGRVVLISSVVG-LLGSAGQANYAASKAGLVGFARSLARELGSRNITFNVVAPGFVDTDMTKVLTDEQRANIVSQVPLGRYARPEEIAATVRFLASDDASYITGAVIPVDGGLGM......... 245
74 -87.5003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  29  1..GSHMSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEV-EALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKTKGKIINACSIAG-HEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVF......... 261
75 -87.2002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  32  7..ERRKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATL-QGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRGGGSVLIVSSVGA-YHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTAS......... 258

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.