current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3mw3_A mol:protein length:208 Neurexin-2-beta, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst GPGSTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLVLast
1 -88.9003mw3_A mol:protein length:208 Neurexin-2-beta  ali model  100  1GPGSTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLV 208
2 -82.9003mw2_A mol:protein length:207 Neurexin-1-alpha  ali model follow..  81  1GP-GSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV 207
3 -77.3002r1b_A mol:protein length:220 Neurexin-1-beta  ali model follow..  80  1GHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRL. 213
4 -72.9003mw4_A mol:protein length:178 Neurexin-2-beta  ali model follow..  65  1GPGSATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGANATLQVDNWPVNEHYPTG----RQLTIFNTQAQIAIGGKDK--------------------------GRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLV 178
5 -72.1003bop_A mol:protein length:175 beta-Neurexin 2D4  ali model follow..  90  1...ATTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAG----RQLTIFNSQAAIKIGGRDQ--------------------------GRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRLV 175
6 -71.4003bod_A mol:protein length:178 Neurexin-1-alpha  ali model follow..  70  2.PLGSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG----RQLTIFNSQATIIIGGKEQ--------------------------GQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV 178
7 -69.9003vkf_C mol:protein length:181 Neurexin-1-beta  ali model follow..  71  1G-SGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG----RQLTIFNSQATIIIGGKEQ--------------------------GQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRL. 176
8 -68.3003b3q_E mol:protein length:197 NRXN1 protein  ali model follow..  70  10.HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG----RQLTIFNSQATIIIGGKEQ--------------------------GQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRL. 185
9 -63.1003biw_E mol:protein length:243 Neurexin-1-beta  ali model follow..  71  52...GTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG----RQLTIFNSQATIIIGGKEQ--------------------------GQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVR.. 224
10 -63.1002r1d_A mol:protein length:226 Neurexin-1-beta  ali model follow..  70  36.HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG----RQLTIFNSQATIIIGGKEQ--------------------------GQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNV... 209
11 -56.5001q56_A mol:protein length:195 Agrin  ali model follow..  11  14...AEAIAFDGRTYMEYHNAVTKSEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLR-STVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSP-----LGATQLDTDGALWLGGMERLSVAHKL---------------PKAYSTGFIGCIRDVIVDRQE-LHLVEDALNNPTIL...... 190
12 -55.8003v64_A mol:protein length:191 Low-density lipoprotein receptor-related prot  ali model follow..  14  1..ALETLAF-DGRTYIEYLNAVIESELTQSNHFELSLRTEATQGLVLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLR-STVKVNTNRWLRIRAHREHREGSLQVGNEAPVTGSSP-----LGATQLDTDGALWLGGLQKL---------------PVGQALPKAYGTGFVGCLRDVVVGHRQ-LHLLEDAVTKPELRP..... 187
13 -55.8002h0b_A mol:protein length:184 Neurexin-1-alpha  ali model follow..  21  1GSKEEYIATFKGSEYFCYDLSQNP-IQSSSDEITLSFKTLQRNGLMLHTG---KSADYVNLALKNGAVSLVINLGSGAFEALVVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQ-----EDYTMLGSDDFFYVGGSPSTADLP-----------------GSPVSNNFMGCLKEVVYKNNDVSRLAKQGDPKMKIHG..... 183
14 -55.6001pz8_A mol:protein length:201 Agrin  ali model follow..  12  12...AEAIAF-DGRTYMEYHNEIPAEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLR-STVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSP-----LGATQLDTDGALWLGGMERLSVAHKL---------------PKAYSTGFIGCIRDVIVDRQE-LHLVEDALNNPTIL...... 196
15 -54.8002r16_A mol:protein length:182 Neurexin-1-alpha  ali model follow..  21  3.REATVLSY-DGSMFMKIQLPVV--MHTEAEDVSLRFRSQRAYGILMATTSRDS-ADTLRLELDAGRVKLTVNLGKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFH------NIETGIITERRYLSS-------------------VPSNFIGHLQSLTFNGMAYIDLCKNGDID.......... 169
16 -54.6001pz7_A mol:protein length:204 Agrin  ali model follow..  12  34..........DALDYPAEP----SEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLR-STVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSP-----LGATQLDTDGALWLGGMERLSVAHKL---------------PKAYSTGFIGCIRDVIVDRQE-LHLVEDALNNPTI....... 198
17 -53.2003pve_A mol:protein length:189 Agrin, Agrin protein  ali model follow..  17  7.SRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIR-SKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESP-----VPHTMLNLKEPLYVGGAPDFSKLAR----------------GAAVASGFDGAIQLVSLRGHQ-LLTQEHVLRAVDVA...... 185
18 -52.7003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  70 1063.DPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG----RQLTIFNSQATIIIGGKEQ--------------------------GQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVR.. 1237
19 -52.4003sh4_A mol:protein length:195 LG3 peptide  ali model follow..  15  2APGQYGAYFHDDGFLAFPGHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVQGKDFISLGLQDGHLVFRYQLGSGEARLV-SEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSP-----GPNVAVNAKGSVYIGGAPDVATLTG-----------------GRFSSGITGCVKNLVLHSAR-PGAPPPQPLDL......... 180
20 -52.1003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  70  222.DPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG----RQLTIFNSQATIIIGGKEQ--------------------------GQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRL. 397
21 -50.1001qu0_A mol:protein length:191 LAMININ ALPHA2 CHAIN  ali model follow..  15  6.NAESGTYF-DGTGFAKA---VGGFKVGLDLLVEFEFRTTRPTGVLLGISSQKM--DGMGIEMIDEKLMFHVDNGAGRFTAIYDPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSAST-----SADTNDPVFVGGFPGG-----------------LNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRG..... 182
22 -48.0001d2s_A mol:protein length:170 SEX HORMONE-BINDING GLOBULIN  ali model follow..  14  2.PAVHLSNGPGQEPIAVMTFDL---TKITKTSSSFEVRTWDPEGVIFYGDTNPK-DDWFMLGLRDGRPEIQLHNHWAQLTVG-AGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVS---------GHPIMRIALGGLLFPASNLR-----------------LPLVPALDGCLRRDSWLD-KQAEISASAPTSLR........ 168
23 -46.6001f5f_A mol:protein length:205 SEX HORMONE-BINDING GLOBULIN  ali model follow..  14  24.........QEPIAVMTFDLT-----KITKTSSSFEVRTWDPEGVIFYGDTNPKD-DWFMLGLRDGRPEIQLHNHWAQLTVG-AGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLT---SKRHPIMRIALGGLLFP-----------------ASNLRLPLVPALDGCLRRDSWLD-KQAEISASAPTSLR........ 186
24 -40.9001h30_A mol:protein length:422 GROWTH-ARREST-SPECIFIC PROTEIN  ali model follow..  11  41....LGRMF-SGTPVIRLRF---KRLQPTRLVAEFDFRTFDPEGILLFAGGHQD-STWIVLALRAGRLELQLRYNGVGRVT-SSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAG--DLFQPERGLYHLNLTVGGIPFH-----------------EKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVN.......... 209
25 -39.3002jd4_A mol:protein length:383 LAMININ SUBUNIT ALPHA-1  ali model follow..  15  19.AGAHQFGL-SQNSHLVLPLQQSD--VRKRLQVQLSIRTFASSGLIYYVAHQNQ-MDYATLQLQEGRLHFMFDLGKGRTKVS-HPALLSDGKWHTVKTEYIKRKAFMTVDGQESPSVTVV-----GKATTLDVERKLYLGGLPSHYRARNIGT----------------ITHSIPACIGEIMVNGQQL.................... 179
26 -39.3002wjs_A mol:protein length:608 LAMININ SUBUNIT ALPHA-2  ali model follow..  15  10...KVSVSS-GGDCVRTYR---PEIKKGSYNNIVVHVKTAVADNLLFYLGSAKF-IDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIEASRTGRNGSISVRALDGPKASMVPSTYHSVSPDVDANAMLFVGGLTGK-----------------IKKADAVRVITFTGCMGETYFDN-KPIGLWNFREKEGDCKG..... 192
27 -38.4001dyk_A mol:protein length:394 LAMININ ALPHA 2 CHAIN  ali model follow..  14  41..........SRNSHIAIAFDDTK--VKNRLTIELEVRTEAESGLLFYM-ARINHADFATVQLRNGFPYFSYDLGSGDTSTMI-PTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKA------DILDVVGILYVGGLPINYTTRR----------------IGPVTYSLDGCVRNLHMEQAPV.................... 192
28 -22.9001za4_A mol:protein length:251 Thrombospondin 1  ali model follow..  11  37GPDPSSPAFRIEDANLIPPVPDDKFQDEKGFLLLASLRMKKTRGTLLALERKDHSGQVFSVVSKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAK--------------------------GGVNDNFQGVLQNVRF......................... 203
29 -20.8002v73_A mol:protein length:191 PUTATIVE EXO-ALPHA-SIALIDASE  ali model follow..  11  14..NYGNLKITKEEERVNITGDLEKFSSLEEGTIVTRFNMNDTSQSLIGLSDGNKANNYFSLYVSGGKVGYELR-GNGDFNVHHSADVTFNRGINTLALKEKGIGAKIFLNGSLVKTVSDPNIKFLNAINL----NSGFIGK---------------------TDRANGYNEYLFRGNIDFMNISDNYLLRKTGETK............ 191
30 -19.9004qvs_A mol:protein length:227 S-layer domain-containing protein  ali model follow..  13  43GLNGNSVSLDGVDDYVALPDGIAGTFYNFTIAFWVRLDTIGEQPIFDFFDSGSNNKYMRLTAESDGKIKFAMT-GYYGEKTITSGSALTEGVWKHVAVTLSGDTGTLYINGENVGENNT---LSLRPLTFLGETSKGYIGK-----------------SHQTDSSEDPYYNSYLHGMIDDFRISADEIKTLASVATR........... 225
31 -17.4004c1w_A mol:protein length:188 NEURAMINIDASE  ali model follow..  12  1GEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGKQNYNDAPLKVKPGQWNSVTFTVEKGRVRLYVNGVLSRTSLRSGNF----IKDMPDVTHVQIGA----------------------TKRANNTVWGSNLQIRNLTVTPEEVQKRS................ 188
32 -16.0003pme_A mol:protein length:420 Type C neurotoxin  ali model follow..  37TIYTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFKDLTNSHNEYTIINSIKQNSGWKLCIRNGNIEWILQDINRKDYSESLSHTGYTNKWFFVTITNNIGYMKLYINGELKQSERIEDLDE------VKLDKTIVFG-------------------------IDENIDENQMLWIRDFNISNEDINIVYEGQILR.......... 220
33 -14.7003obr_A mol:protein length:434 Botulinum neurotoxin type D  ali model follow..  44TIYTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFKDLTNSHNEYTIINSIEQNSGWKLCIRNGNIEWILQDVNRKYKSESLSHTGYTNKWFFVTITNNIGYMKLYINGELKQSQKIEDLDE------VKLDKTIVFGI-------------------------DENIDENQMLWIRDFNISNEDINIVYEGQIL........... 226
34 -14.6002vu9_A mol:protein length:444 BOTULINUM NEUROTOXIN A HEAVY CHAIN  ali model follow..  52KNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN--YTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKYSQMINISDYINRWIFVTITNNRNNSKIYINGRLIDQKPISNLGN------IHASNNIMFKL-------------------------DGCRDTHRYIWIKYFNLNEKEIKDLYDNQSN........... 234
35 -14.5004kbb_A mol:protein length:459 Botulinum neurotoxin type B  ali model follow..  57.DKNQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFKYKNDGIQNYIHNNCMKNNSGWKISIRGNRIIWTLIDINGKEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIRE------VIANGEIIFKL-------------------------DGDIDRTQFIWMKYFSISQSNIEERYKIQSYSEYLK...... 247
36 -14.4004jra_A mol:protein length:443 Botulinum neurotoxin type A  ali model follow..  52KNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN--YTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKYSQMINISDYINRWIFVTITNNRNNSKIYINGRLIDQKPISNLGN------IHASNNIMFKL-------------------------DGCRDTHRYIWIKYFNLNEKEIKDLYDNQSN........... 234
37 -14.1001d0h_A mol:protein length:469 PROTEIN (TETANUS TOXIN HC)  ali model follow..  61GINGKAIHLVNNESSEVIVHKAMD-DMFNNFTVSFWLRVPKVSAISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRLPDKFNAYLANKWVFITITNDRSSANLYINGVLMGSAEITGLGA------IREDNNITLKL-------------------------DRCNNNNQYVSIDKFRINPKEIEKLYTSYLSI.......... 255
38 -14.1003fuq_A mol:protein length:417 BoNT/F (Neurotoxin type F)  ali model follow..  41TNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNYTQMISISDYINKWIFVTITNNRGNSRIYINGNLIDEKSISNLGD------IHVSDNILFK--------------------------IVGCNDTRYVGIRYFKVGKTEIETLYSDEPDPSIL....... 229
39 -13.9003r4s_A mol:protein length:443 Botulinum neurotoxin type C1  ali model follow..  44IFPFDFKLGSSGEDRGKVIVTQNENSMYESFSISFWIRINKWVS-GYTIIDSVKNNSGWSIGIISNFLVFTLKQNEDSESYDISNNAPGYNKWFFVTVTNNMGNMKIYINGKLIDTIKVKELTG-----------------------INFSKTITFEINKIPDTGLITSDSDNINMWIRDFYIDGKDINILFNSLQYT.......... 235
40 -13.9001fv2_A mol:protein length:472 TETANUS TOXIN HEAVY CHAIN  ali model follow..  68GINGKAIHLVNNESSEVIVHKAMD-DMFNNFTVSFWLRVPKVSAISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRLPDKFNAYLANKWVFITITNDLSSANLYINGVLMGSAEITGLGA------IREDNNITLKL-------------------------DRCNNNNQYVSIDKFRINPKEIEKLYTSYLSI.......... 262
41 -13.6003azv_A mol:protein length:443 D/C mosaic neurotoxin  ali model follow..  50IFPFDFKLGSSGDDRGKVIVTQNENAMYESFSISFWIRINKSNLPGYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQYDISKNAAGYNKWFFVTITTNMGNMMIYINGKLIDTIKVKELTG-----------------------INFSKTITFQMNKIPNTGLITSDSDNINMWIRDFYIDDKDINILFNSLQYTNVVK...... 245
42 -13.4004isq_A mol:protein length:431 Neurotoxin  ali model follow..  45..DFKLGSSGDDRGKVIVTQNENIVYNAMYESFSISFNKWVSNLPGYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQYDISKNAAGYNKWFFVTITTNMGNMMIYINGKLIDTIKVKELTG-----------------------INFSKTITFQMNKIPNTGLITSDSDNINMWIRDFYIDDKDINILFNSLQYTNVV....... 235
43 -13.1002vxr_A mol:protein length:482 BOTULINUM NEUROTOXIN TYPE G  ali model follow..  77DIGNGQFKLNNSESNITAHQSKFVVYDSMFDNFSINFPKYNNNDIQTYLQSCIKNDSGWKVSIKGNRIIWTLIDVNAKEYSIKDNISDYINKWFSITITNDRGNANIYINGSLKKSEKILNLDR------INSSNDIDFKL-------------------------INCTDTTKFVWIKDFNINATEVSSLYWIQSSTNTLKD..... 271
44 -13.0004b1m_A mol:protein length:185 LEVANASE  ali model follow..  12  49.......................SSASGSDFTYESDITIKDGNALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAH.......................................................................................... 148
45 -12.4003flp_A mol:protein length:217 SAP-like pentraxin  ali model follow..  11  5..RDVKISFPGTQNPKFPHLFMQTLPAVRQLTVCQRIKPFHRNTGYIFSCATSNQDNQFITSMSDGTLNLGLQVNASSNKYISCPIEIELGQWYHVCHVGVDGRMAVYANGSPCGTME-----NVGKGHQISAGGTVVIGQEQDKI-------------------GGFEEQESWSGELSDLQVWDEALTTSTVASCNGIRPRGNV... 193
46 -12.3004azz_A mol:protein length:172 LEVANASE  ali model follow..  12  17GTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAH.......................................................................................... 137
47 -11.9002uur_A mol:protein length:245 COLLAGEN ALPHA-1(IX) CHAIN  ali model follow..  16  56GSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTGSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVD.................................................................................................. 174
48 -11.2003v0a_B mol:protein length:1196 NTNH  ali model follow..  10  874GINSDALYLNGSNQSISFSNDFFENGLTNSFSIYFWLRNLGKDTIKSKLIGSKEDNCGWEIYFQDTGLVFNMIDSNGNEK-NIYLSDVSNNSWHYITISRLKEQLLIFIDDNLVANESIKEILN------IYSSNIISLLS------------------------------ENNPSYIEGLTITSQEVLSNYFEVLNN.......... 1041
49 -11.1004pbp_A mol:protein length:210 C-reactive protein  ali model follow..  8..SGKVLQFKTATDNSYVKLYPEKPLSLSAFTLCMRVATELPLD-ILFAYYTPDVDELNVWRERDGRVSLYIQ---SSKDAAFFRLPPLSTLQTHLCVAWESATTAFWMDGRRSLHQVYRKGYS------IRSGGTVVLGQDPDS--------------------GSFDVDQSFVGEIANLQMWDYVL-NVFDWDTIEYDVTGNVLV. 206
50 -10.7003zyp_A mol:protein length:218 CIP1  ali model follow..  38GSNSMKVV-GGPNGYCGHIFFGTTQVPTGDVYVRAWIRLQTALGTFIIMPDTAQGGKHLRIGGQSQVLDYNRTLPDLSPNGIASTVTLPTGAFQCFEYHGTDGTIETWLNGSLIPGMTVGPGVDN------PNDAGWTRASYIPEITGVNFGWEAYSGDVNTVWFDDISIASTRVGC............................... 217
51 -10.3001gyk_A mol:protein length:204 SERUM AMYLOID P-COMPONENT  ali model follow..  10  5..SGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLV-YKERVGEYSLYIGRHKVTSKVI---EKFPAPVHICVSWESSSAEFWINGTPLVKKGLRQGYF------VEAQPKIVLGQEQDSY-------------------GKFDRSQSFVGEIGDLYMWDSVL-NILDWQALNYEIRGYVII. 198
52 -9.7301b09_A mol:protein length:206 PROTEIN (C-REACTIVE PROTEIN)  ali model follow..  5..SRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTETRGYSIFSYATKRQDNEILIFWSKDIGYSFTVG-----GSEILFEVPEVTVAPVHICTSWESASVEFWVDGKPRVRKSLKKGYT------VGAEASIILGQEQDSF-------------------GNFEGSQSLVGDIGNVNMWDFVL-NVLNWRALKYEVQGEVFT. 200
53 -9.6304zkt_B mol:protein length:1163 Botulinum neurotoxin type E, nontoxic-nonhema  ali model follow..  837GINNNAIHLTGANQNIKFTNDYFENGLTNNFSIYFWLRNLKQNTIKSKLIGSKEDNCGWEIYFENDGLVFNIIDSNGNEK-NIYLSNISNNSWHYIVISRLKDQLLIFIDNILVANEDIKEILNIYSSDIISLLSDNNNVYIEG................................................................ 981
54 -9.3203vuo_A mol:protein length:1196 NTNHA  ali model follow..  871GVNGESLYLKSPNETVEFSNNFFTNGLTNNFTICFWLRFTGKDDDKTRLIGNKVNNCGWEIYFEDNGLVFEIIDSNGNQES-VYLSNVINNNWYYISISRLKDQLLIFINDKNVANVSIEQILNIYSTNVISLVNKNNSIYVEE................................................................ 1015

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.