current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490
# Score Template Links and tools%idFirst MGSPFLRGTVEKEVTKVKQSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLDIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSESNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLGPGEDTATKLELast
1 -137.0003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model  100  1MGSPFLRGTVEKEVTKVKQSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLDIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSESNSKPSPDGTSALYGVAGSVKTAGVADKLIVGFLDALYKLGPGEDTATKLE 491
2 -125.0004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  40  22RKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLK--EYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPD-SCGCVTSGGTESILMACKAYRDLAF-EKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTK-MMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELEN-IKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARVAIQFLKDIRESVTQIMKNPK--AKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQ... 503
3 -121.0003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  38  35CEIRGIQSQPPDPTMDWLASLRSQIKPYRDRFPSHARLPRAGLPRAEILAEIAAMGAAE-SPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDAATVCGTVTSGGTESLLLAMKTYRDWARATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPLDA-DYRADVAAMREAITPNTVVVAGSAPGYPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPWAERLGYP-VPPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHYQYFIAADWPGGLYFSPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRA-IPSLKILGDP-LWVIAVASDELNIYQVMEEMAGRGWRLNGLHRPPAFHVALTLTEPGVVDRFLADLQDAVAQVRAHPE---KATGMAPVYGMAAAAPPE-LVRQVLTGFIDLLYEV........... 512
4 -120.0005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  38  31CEIRGIQSQPPDPTMDWLASLRSQIKPYRDRFPSHARLPRAGLPRAEILAEIAAMGAAE-SPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDAATVCGTVTSGGTESLLLAMKTYRDWARATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPLDAD-YRADVAAMREAITPNTVVVAGSAPGFPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPWAERLGYP-VPPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHYQYFIAADWPGGIYASPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRA-IPSLKILGDP-LWVIAVASDELNIYQVMEEMAGRGWRLNGLHRPPAFHVALTLTEPGVVDRFLADLQDAVAQVRAHPE---KATGMAPVYGMAAAAPPE-LVRQVSTGFIDLLYEV........... 508
5 -119.0004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  32  18KNLPGVNQIIEKELNKELSSTREKLRIQRSGMTLREEIPEEGLSPQDILSAFDVDVEKEFLVGRGDGKDSGALYIHPKELTELLKEVYGATALTNPLH-DKWPRINAMQAEVIRWCQNLFHGSKE-GYGLLTHGGTTSIIEAMAAYVIRARA-KGIDYPEIVVPETAHAAFKKAAELTGAILITVPVDKKTGAVNPNVMSSYITRNTAVMVGSAPSFMNGIHDPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSS----EPMDFRVPGVTSISADLHKYGCCPKGTSVCLFSE-DSPALSVYAALNWSGGLYATPILDGSTSGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALVEDIYVYGNPQWSILGFRSNTCNAHFIADELEKRGWKLNLLQNPDGFHLCLTHVHGSFETQFIKDLREAVIDVKNYPPGKK-PSGNVKVYGAVGMMPQKEICKQYQKARLDFTAASHGSLGIFAPSS 530
6 -87.3003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  21  2..................................MRNMQEKGVSEKEILEELK--KYRSLDLKYEDGNIFGSMCSNVLP---ITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLNNKD--AYGHIVSGGTEANLMALRCIKNIWREKRKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPIKED-YTIDEKFVKDAVEDYDVGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKYKKK-YKFDFSL-GVDSITIDPHKMGHCPIPSGGILFKDIGYKRYLDVDAPYLTETR--QATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKEN--NFKPVIEPILNIVAIEDE--DYKEVCKKLRDRGIYVSVCNCVKALRIVVMPIKREHIDNFIEILNSIKRD....................................................... 397
7 -81.0003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  20  21..........................RYVRTSLPRFKMPENSIPKEAAYQIIN--DELMLDGNPRLNLASFVTTWMEPECDKLIMSSINK----NYVDMDEYPVTTELQNRCVNMIAHLFNAPAETAVGVGTVGSSEAIMLAGLAFKRKWQNKRPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKDTPIHVDAASGGFIAPFLYPE------EWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPLVAFSLKDHTEFEISDMLRRYGWIVPAYTMPPNAHITVLRVSRTLAERLVIDIEKVMRELDELPSRVIHKISLGQEKSESLMVTVKKSDIDKQRDIITGWKKFVADRKKTSGI. 501
8 -78.6001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  19  1........MDKKQVTDLRSELLDSRFGAKSTIAESKRFPLHEMRDDVAFQIIN--DELYLDGNARQNLATFCQTWDDENVHKLMDLSINK----NWIDKEEYPQSAAIDLRCVNMVADLWHAPNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMPTDKPNLVCG-PVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFDIDMHIDAASGGFLAPFVAPD------VWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICPDEGIPAVCFKLKDYTLYDLSERLRLRGWQVPAFTLGGEADIVVMRIEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKH..................................... 465
9 -78.6001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  19  1........MDQKLLTDFRSELLDSRFGAKSTIAESKRFPLHEMRDDVAFQIIN--DELYLDGNARQNLATFCQTWDDENVHKLMDLSINK----NWIDKEEYPQSAAIDLRCVNMVADLWHAPNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMPTDKPNLVCG-PVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFDIDMHIDAASGGFLAPFVAPD------VWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICPDEGIPAVCFKLKDYTLYDLSERLRLRGWQVPAFTLGGEADIVVMRIEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT.................................... 466
10 -46.4002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  15  20.....IEGLIPKNMEKRGELVLNEYLKEIEDVFNHRKIPENGIDDEKIKLFLKFLSMMDTD-KDPKSVRIG--EREARTYSKIHEELSSGFCHGIGRSGNLVSIMYALTNKILESFFKQLGLNVHAIATPISTGMSISLCLSAARKKY--------GSNVVIYPYASHKSPIKAVSFVGMNMRLVELDGDRVYVPVEDIENAIKKNRPCVLSTLTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNYYLE-----LKKAFKYRVDAVVS---SSDKNLLTPIGGGLVYSTDAEFIKE---ISLSYPGRASATPVVN----------TLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYVRTEDIVNSVSKLEKIL......................................................... 449
11 -36.0004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  16  29.....VQQVVDLILAKLTGAAERPPMPETVDLPGPITIPEAAATEATLLQAIRDMVDGSMNPANPG---YIGHMDPMPATMAILGDLVAAAVNNNMLSLEMSPSFSRLETLLLRAIAGLFGLGEQAG-GVLTSGGSLANLQALAVARNVAFDSVLAQRPVIFASEAAHTSLQKAAMLLGLAVIPVRAT-ADSRMDPEDLRARIDQARFCVVATAGTTTTGNIDPLAEIGAIAREHGLWFHVDAAYGGALV----------SERHRWRLAGIESITFNPQKWLYVAKTCAMVLFRDAGVLERAFRIPAPYM--NLGEIGVQGTRHADVV-KLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQR-PFLRLAGEIDTNIVCFRGEPDWL-ALQALLLREG-FLSLPVYRGGRWLRAVLLNPYTTDAVIDAMFKQIDRFAGR................................................... 480
12 -34.8004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain prot  ali model follow..  15  33.....VHDFCAEKHEIHDQPVVVEAKEHQEDKIKQIKIPEKGRPVNEVVSEMMNE--VYRYRGDANHPRFFSFVPGPASSVSWLGDIMTSAYNIHAGGSKLAPMVNCIEQEVLKWLAKQVGFTENPG-GVFVSGGSMANITALTAARDNKLTDINLHLGTAYISDQTHSSVAKGLRIIGIRIRRIPTN-SHFQMDTTKLEEAIETDKFVVIGTAGTTNTGSIDPLTEISALCKKHDMWFHIDGAYGASVL----------SPKYKSLLTGTGSISWDAHKWLFQTYGCAMVLVKDIRNLFHSFHVNPEYLKDLTWDIGMELTRPARGL-KLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPK-KDWEIVSPAQMAMINFRYAPKDL-KISHRILESG-AIFTTVLNGKTVLRICAIHPEATQ---EDMQHTIDLLDQYGREIYTEMKKA........................................ 490
13 -34.4002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2  ali model follow..  16  41.....TTSAMKSVFEQVNAPYSGMDPKALEDAINAVDLDNKNAPLKSVIDDVAEL--VAKNAIFTQHPDCIAHLHTPPLMPAVAAEAMIAALNQSMDSWDQASSATYVEQKVVNWLCDKYDLSEKAD-GIFTSGGTQSNQMGLMLARDWIADKDYADKLRIVCSKKSHFTVQKSASWMGLAVMTVDAN-ADGTMDITKLDEVIAQAKFAIVGTAGTTDHGAIDDLDFIADMAVKHDMWMHVDGAYGGALI----------LSSHKSRLKGVESISVDFHKLFYQTISCGALLVNDKSNFKFDYLNREHDELPNLVDKSIATTKRFDAL-KVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTN-DQFELLAEPSLSTVLFRATHETA-ALRLEALTRG-VLGETIVDGKTALKFTILNPCLTTSDFESLLSKINMLAVE................................................... 495
14 -31.8003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  13  34ILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFN--LELSDHPESLEQILVDCRDTLKYGVRTGHPR---FFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSKDGDGIFSPGGAISNMYSIMAARYKYKGMAAVPKLVLFTSEQSHYSIKKAGAALGFNVILIKCN-ERGKIIPADFEAKILEAKFYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLL----------SRKHRHKLNGIESVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMHASYL--DTGDKAIQCGRHVDIF-KFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFGEPEHTNVCFWYIPQSL-KIKALMMESGTTMVGYQ-PQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQD................................................ 504
15 -31.7002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  14  36...........VKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPR---YFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFSPGGAISNMYAMMIARFKEKGMAALPRLIAFTSEHSHFSLKKGAAALGISVILIKCD-ERGKMIPSDLERRILEAKFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLL----------SRKHKWKLSGVESVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYL--DTGDKALQCGRHVDVF-KLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFGKPQHTNVCFWYIPPSL-VIKARMMEYGTTMVSYQ-PLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQD................................................ 497
16 -31.6002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  16  41..FGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVKTGHPR---FFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWSSGD--GIFCPGGSISNMYAVNLARYQRRGLRTLPPLALFTSKECHYSIQKGAAFLGLSVRVVKAD-ERGKMVPEDLERQIGMAEFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVL----------SQTHRHLLDGIQSVAWNPHKLLAAGLQCSALLLQDTSLLKRCHGSQASYL--DTGDKVVQCGRRVDCL-KLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKR-EGFELVMEPEFVNVCFWFVPPSL-VLKERMVKEGSMMIGYQ-PHGTRGNFFRVVVANSALTCADMDFLLNELERLGQD................................................ 508
17 -23.4001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  13  28...................QVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKI--MPGVTHWHSPYFFAY-FPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGAYASDQAHSSVERAGLIGGVKLKAIPSD-GKFAMRASALQEALERDKFFVVATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGFICP-------------EFRVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHSHQGSGLITDYRHWQLLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQD-PRFEVCAEVTLGLVCFRLKGSDGLALLERINSARKIHLVPCRLRGQFVLRFAICSRKVES--GHVRLAWEHIRGLAAELLAAEEGKA....................................... 482
18 -23.1004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  15  33...................RVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERI--MPGVVHWQSPHMHAY-YPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPESQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDAYASDQAHSSVEKAGLISLVKMKFLPVD-DNFSLRGEALQKAIEEDKVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGFLCP-------------EFRIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHDFMHWQIPLSRRFRSV-KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRND-PSFEIPAKRHLGLVVFRLKGPNSLNVLKEIAKAG-FLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATL................................................... 477
19 -23.1003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  15  28...................QVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKI--MPGVTHWHSPYFFAY-FPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPEAYSSDQAHSSVERAGLIGGVKLKAIPSD-GNFAMRASALQEALERDKFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGFICP-------------EFRVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQILKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQD-PRFEICVEVILGLVCFRLKGSNKVALLQRINSAK-HLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAAD................................................... 473
20 -22.9003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  15  28...................RVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERV--MPGVTHWHSPKFHAY-FPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEGYCSDQAHSSVERAGLLGGVKLRSVQSE--NHRMRGAALEKAIEQDVFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGFICP-------------EYRIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDYRHWQIPLGRRFRAL-KLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVAD-SRFELAAEINMGLVCFRLKGSNERALLKRINGRGHIHLVPAKIKDVYFLRMAICSRFTQS--EDMEYSWKEVSAAADEMEQEQ........................................... 475
21 -22.3003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  5.SFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEKGKCPENGWDESTLELFLHELAIMDSNVGEREGRVASALVARRHDISAVQPKAAGS---------SLLNKITNSLVLDIIKLAGVHTVANCFVVPMATGMSLTLCFLTLRHKRPKAK--------YIIWPRIDQKSCFKSMITAGFEPVVIELEGDELRTDLKAVEAKVPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSS-------CMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQE-------------ISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSE-LHTPHNPISLAMTLEHRDKAVTQLGSMLFTRQFMSHTNNYPCAYLNAASAIKMQDVDLFIKRLDRCLKAVRKERSKESDDN........................................... 472
22 -19.6003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  1...............RQGCEARRAHEHLIRLLLEQGKCPEDGWDESTLELFLHELAVMDSNN--REGRVASALV---ARRHYRFIHGIGRSGDISAVQPKASSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAK-----YIIWPRIDQKSCFKSMVTAGFEPVVIELEGDELRTDLKAVEAKIPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSS-------CMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNEPFIQD-------------ISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAENERLLQTPHNPI---GHHDKAVTQLGSMLFTRQ-HADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVRKEQTRA............................................... 450
23 -18.4004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  17  12......................................................................AATTPMHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIE-EARELIADKLGARPSEVI--FTAGGTESDNLAVKGI--WARRDAEPHRRRIVTTEVEHHAVLDSVNWLGAHVTWLPTAAD--SVSATALREALHDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLPL------------DFGASGLSAMSVAGHKFG-GPPGVGALLLRRDVTCVPLMH------GGGQERDIRSGTPDVASAVG-MATAAQIAVDGLEENSARLRLLRDRLVEGVLAEIDDVCLNGADGIECSTGSACTAGVAQPSHVLIAMG--VDAASARGSLRLSLGHTSVE-VDAALEVLPGAVARARRAA.................................................. 390
24 -17.7001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  14  22.....................................................................FGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTI--TITDNVTTGCDIVLWGLD---------QGDEILLTDCEHPGVQAIAARFGITYRFFPVAATLNQGDAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQVRVLVDGAQSAGSLPL------------DFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGE----INPTYVGWRSITYGAKATSAYPQYAGLLAALQLHQRQGTAEEYQAICQRSEFLWRGLNQ-LPHVHCLAAPQAGLVSFTVDSPLGHRIVQKLEEQRIYLRTIADPDCIRACCHYITDE-INHLLARLADF.......................................................... 388
25 -17.1005i90_A mol:protein length:427 PvdN  ali model follow..  15  93.......................................................................................................EIWKYEDEARAWAGRYFAVQPGQVA--LTGSTTDGLAAIYGGLL---------PGKEILTSSHEHTTLEYRHKRMGTQVREFPLFKDPHRVSLSSIAAQIRPQTRVLGMTWVQSGSGVKLPIREIGKLVRELNIIYVVDGVHGFGVEDV------------SFADFDCDYFIAGTHKWLFGPRGTGVIIARSEQLQEHLVPSIPTFSRADNFGTLMGGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGE-HPKVRLVTPTSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVDRDVGPVVRLAP-DEAEIDRVLEILAPQLA........................................................ 427
26 -17.0003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  14  43.............................................................................QAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESL----AKMIGGKPQDII--FTSGGTESNNLVIHSVVKHFHANQTSAKPHFITSSVEHDSIRLPLEHLVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNILVHTDAAQALGKQRV------------DVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLF-----GGGQERNFRPGTENTPMIAG-LGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNPNTCNFSIRGPRLQGHVVSPVLLSYG--VPFDVARNALRLSVGRSTTR-VDLVVQDLKQAVAQLEDQA.................................................. 440
27 -17.0004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  13  10.......................................................................ATTFIDPRVKEFIISLMDKELNPSSAHSFAKNLIETVRAQIATALGITLSSREYDIT--FTSSGTEGNNLIM----------KNFYDGDIFISAIEHLSIYNHINYAP-NIKVISVNTQ--LVDLEHLEELLAQSNTLVSIIMANNESGVLQDIAEIGKITKKYEAKFHSDLVQGFGRIPI------------NIKALGLDFATISGHKIG-GGQGGAALISSSNFQITPMII------GGGQEKSVRSGTENVLAIAG-FGLASALRTDNISENYIKIKKLQENLEKKLKK-YPNVNIVSNNQAKLIGFDLHNICVISKSHVLTNMG--VGEEEAKSSIRISLSHTNTV-IEAFIEAFEEIYDVIPS.................................................... 374
28 -16.8003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  13  36.............................................................................QAVTEAMKEAWGNPSSSYVAGRKAKDIINTARASL----AKMIGGKPQDII--FTSGGTESNNLVIHSTVRCFHEQQTLTRPHFITCTVEHDSIRLPLEHLVAEVTFVPVSKVNGQVEVEDILAAVRPTTCLVTIMLANNETGVIMPISEISRRIKALNVLVHTDAAQALGKRRV------------DVEDLGVDFLTIVGHKFYGPRIGALYVRGVGKLTPLYPMLF-----GGGQERNFRPGTENTPMIAG-LGKAADLVSENCETYEAHMRDIRDYLEERLEAEFGKRIHLNSPNTCNFSIQGSQLRGYMVSDHEDRPSPVLLSCGIPNAVRLSVGRSTTR-VDLIVQDLKQAVNQLEG.................................................... 430
29 -16.2003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  17  22.......................................................................ATTRVDQRVADIVLHWMTA-EFGNAGSRHEYGIRAKRGVERARYLASTVSAEPDELI--FTSGATESNNIALLGLAPYGERT---GRRHIITSAIEHKAVLEPLEHLGFEVDFLTPGPSGR-ISVEGVMERLRPDTLLVSLMHVNNETGVIQPVAELAQQLRATPTYLHVDAAQGYGKVPG------------DLTTP-IDMISISGHKI-GAPKGVGALVTRRREEMDDERVLEPIMFGGGQERKLRPGTLPVPLIMG-LAEAAKIFEAEHAQWQVAAQDLRSRLLAGLAS--TSFQVNGDQDHVVFEDVDAEAFLVTLKDLVATPSHVLRAMGLPEEASLRFSWTPGQATDLDVEELARGVAKLKPS................................................... 393
30 -15.9001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  17  8.....................................................................NATTRVDDRVLEEMIVFYREKYGNPNSAHGMGIEANLHME-KAREKVAKVLGVSPSEIF--FTSCATESINWILKTVAETFEKRKR----TIITTPIEHKAVLETMKYLGFKVKYVPVDSRGV-VKLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDVTRIVKKKNTLVHVDAVQTIGKIPF------------SLEKLEVDYASFSAHKF-HGPKGVGITYIRKGVPIRPLIH------GGGQERGLRSGTQNVPGIVG-AARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHQNLLSGYGIYVSTSSACTSKDERLRHVLDAMG--VDRRIAQGAIRISLCKYNTE-VDYFLKKIEEILSFLDLTGN................................................. 381
31 -15.9002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  15  41..........................................................................................FCTTGRLDEIKTPPIHDFIHNQL---PKFLGCDV-----RVTNGAREAKFAVMHSLAK--------KDAWVVMDENCHYSSYVAAERAGLNIALVPKDYPDYAITPENFAQTIEETKVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPV------------SLKEIGADFIVGSGHKS-MAASGPIGVMGMKEEWAEIVLRRSEKYK--NKEVELLGCTARGATIITLMASFPHV--RERIKRWDEEVEKARRFAAEMEKL--GIKQLGDNPHNHDLMFFHAEVLYEISRELKSRKIHGIKPGLTRYFKLSTYGLSDEEVDYVLNAFKEIIEKYS..................................................... 371
32 -15.8003wkr_A mol:protein length:416 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  13  17LEGPYSKKFEVITLDINLDKYKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGR----------------------------LDEVTCPPIKDFLEDIAKFL--------NMDCARPTHGAREGKFIVMHAICKEG--------DYVVLDKNAHYTSYVAAERAKLNVAEVGYEEPTYKINLEGYKEVIDKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPV------------NGKEVKADFIVASGHKSMAASAPCGILAFSEEFS---DKITKTSEKFPVKEIEMLGCTSRGLPIVTLMASFPHV---ERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLD-FFFYDELKKRGIGGIRAGVTKEIKMSVYGLEWEQVEYVVNAIKEIVESCK..................................................... 410
33 -15.3001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  13  26.....................AEDLIPKEHLREVPPRLPE--VDELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHE---EAARLFADLHPYQDRTAQGALRLMWELGEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHEDRGEGR--TRRVVLVPDSAHGSNPATASMAGYQVREIPSGPE--EVDLEALKRELGPHVAALMLTNPNT--GLFERILEISRLCKEAGVQLYYDGANLNAIMGWARPGDM-----------GFDVVHLNLHKHGGGGPGSGPVGVKAHERGEEGFYLDFDRPKSIGRVRSFYGN---LALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQPPEGFRALDLAKGLLELGFHPPTVYFPLIVKEALMTEAKETLEAFAEAMGALLKKPKEWLENAPYSTPVRRLDELRAN................................ 463
34 -15.3003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  18  69.................................................................................................................NQIADLVGADPREIV--FTSGATESDNLAIKGAANFYQKKGK----HIITSKTEHKAVLDTCRQLGFEVTYLAPQRNGI-IDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPI------------DLSQLKVDLMSFSGHKYG--PKGIGALYVR----RKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAY-RIAKEEMATEMERLRGLRNRLWNGIKD-IEEVYLNGDLEHGAFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIR............................................................... 367
35 -15.1004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  15  17...............................................................................LEAMLPYMTESFGNPSSVHSYGFKAREAVQ-EAREKVAKLVNGGGGTVV--FTSGATEANNLAIIGYAMRNARKGK----HILVSAVEHMSVINPAKFLGFEVEYIPVGKYGE-VDVSFIDQKLRDDTILVSVQHANNEIGTIQPVEEISEVLAGKAA-LHIDATASVGQIEV------------DVEKIGADMLTISSNDI-YGPKGVGALWIRKEAKLQPVIL------GGGQENGLRSGSENVPSIVG-FGKAAEITAMEWREEAERLRRLRDRIIDNVLK-IEESYLNGHPEKRLVNVRFSYIEGESIVLSLDMAGIQASTGSACSSKTLQPSHVLMACVDRLLEVLPGVIERLRSMSP................................................. 378
36 -14.8004lgl_A mol:protein length:983 Glycine dehydrogenase [decarboxylating]  ali model follow..  13  502...........................................SETELLRYLHQLESKDLALNTSMIPLGSCTMKLNA-TAEMMPVTWPEFGKIHPFAPGQTEGYQILFAQLEAWLGEITG----DAISLQPNAGSQGEYAGLQVIRQYHLSRGEEQRNICLIPESAHGTNPASAVMCGMQVVPVKCDGE--NIDVEDLTSKAEKYGDRLAALMVTYPHGVFEAIGTICDIVHRFGGEVYMDGANMNAQVGLCRPADF-----------GADVCHLNLHKHGGGGPGMGPIGVKSH-LPRTSLNSTAELQAEDQSIGMISAAPYGSALVISWMYIAMMGPQGLTKATEVAILSANYMAKRLENYYPILFRGNNELVAHECIKQAAIEVEDVAKRLMDFGFHAPTVSWPVLGTMMVEPTESESLDRFCDAMIAIYQEAQAITHGEIDPADN......................................... 916
37 -14.1004lw2_A mol:protein length:404 Cysteine sulfinate desulfinase  ali model follow..  15  28.....................................................................SAATALKPEAVVEATQQFYSLSAGNRSQFAEAQRLTARYEAA--EKVAQLLNAPDDKTI-VWTRGTTESINMVAQCYARPRLQPGD----EIIVSVAEHHAWLMVAQQTGAKVVKLPLNAQ--LPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPA------------DVQQLDIDFYAFSGHKL-YGPTGIG-VLYGKSELLEAKMVHEVSFDGFTTQSAPWKLEAGTPNVAGV-AALEWLADYDINQAESWSRSLATLAEDALAK-RPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRA-AQPLLAELGVTGTTKSDVDALVNAVDRALELLVD.................................................... 404
38 -13.3003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  13  28...........................................................................AGMLIPDSVATTVSTAFRRSGASTVGAHPSARRSAAVLEAVADLVNADPGGVV--LGADRAVLLSLLAEASSSRAGL------YEVIVSRLDDEAWLRAAHRYGAKVKWAEVDIETGELPTWQWESLISKSTRLVAVNSASGTLGGVTDLRAMTKLVHDVGALVVVDHS----AAPYR---------LLDIRETDADVVTVNAHAWG---PPIGAMVFRDPSVMN-SFGSVSTNPYATGPARLEIGVHQFGLLAGVVASIEYLAAVSMQSADAYLNRVFDYLMVSLRS-LPLVMLIGRPEIPVVSFAVHKVPADRVVQRLADNG-VLGVNDVGGAVTVGLAHYSTM-VDQLVRALASL.......................................................... 399
39 -13.1004w91_A mol:protein length:422 Aminotransferase  ali model follow..  15  38.......................................DNGASAQKPQSVIDAVTHAYANEYANVHRGLHFLSNAATDAYEKSRETVRRFLNAGSVDEIVF-----------------------------TKNATEAINTVAYGYGMPFIGEGD----EILLSIMEHVPWHFIRERQGAKLVFTPVDDN--VFHIEEFEKRLSERTKLVAITHMSNTLGTVVPIKKIVELAHARGIPVLVDGSQGAVHLPV------------DVQDLGCDWYVFTGHKV-YGPSGIG-VLYGRAQMLEKEMIEEVTEENVTYNHPPHRFEAGTPPIVQA-AALEYMEKIGRHAILAHEADLRDYAHERLGR-INSLRIFGNAPGAIISFALEGIHAHDVSMVIDRAGVAVRA-AQPLLKRFGVTSTTRAEVDALAEALEKARKFF...................................................... 415
40 -13.1001t3i_A mol:protein length:420 Probable cysteine desulfurase  ali model follow..  15  33.......................................DNAATSQKPRAVLEKLMHYYENDNANVHRGAHQLSVRATDAYEAVRNKVAKFINARSPREIVY-----------------------------TRNATEAINLVAYSWGMNNLKAGD----EIITTVMEHVPWQMVAAKTGAVLKFVQLDEQE-SFDLEHFKTLLSEKTKLVTVVHISNTLGCVNPAEEIAQLAHQAGAKVLVDACQS---APHYP----------DVQLIDCDWLVASGHKM-CAPTGIG-FLYGKEEILEAEMIAEVFFDHFTTGELPHKFEAGTPAIAEA-AAVDYLTDLGMENIHNYEVELTHYLWQGLGQ-IPQLRLYGGDRAALASFNVAGLHASDVATMVDQDGIAIRS-TQPLHRLFDASGSTKEEIDLFLQSLQATIRFFSD.................................................... 415
41 -12.6001jf9_A mol:protein length:408 SELENOCYSTEINE LYASE  ali model follow..  15  30.......................................DSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHTLSAQATEKMENVRKRASLFINARSAEELVF-----------------------------VRGTTEGINLVANSWGNSNVRAGD----NIIISQMEHVPWQMLCARVGAELRVIPLNPD--TLQLETLPTLFDEKTRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVD---GAQAVMHHP----------DVQALDCDFYVFSGHKL-YGPTGIG-ILYVKEALLQEM----PPWEGGGSMIATVAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLES-VPDLTLYGPQNLGVIAFNLGKHHAYDVGSFLDNYGIAVRT-AMPLMAYYNVPAMTHEEVDRLVTGLQRIHRLL...................................................... 407
42 -12.5001v72_A mol:protein length:356 Aldolase  ali model follow..  12  12..........................................................................FSSDNIAGASPEVAQALVKHSSGQAGPY-GTDELTAQVKRKFCEIF---ERDVEVFLVPTGTAANALCLSAMTPPWGN--------IYCHPASHINNDEAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKV-ACVSITQATEVGSIDEIEAIGDVCKSSSLGLHMDGS-------FANALVSLGCSPAEMTWKGVDALSFGATKNGVL--AEAIVLFNTSLATEMSYR-----------------RKRAGHLSSKMRFLSYLTDDLWLRNARKANAAAQRLAQGLEG-LGGVEVLGGTEANILFCRLDS----AMIDALLKAGFGFYHDRWGPNV-VTSFATTAEDVDHLLNQVRLAADRTQER................................................... 356
43 -12.5001c0n_A mol:protein length:406 PROTEIN (CSDB PROTEIN)  ali model follow..  15  28.......................................DSAASAQKPSQVIDAEAEFYRHGYAAVHAGAHTLSAQATEKMENVRKRASLFINARSAEELVF-----------------------------VRGTTEGINLVANSWGNSNVRAGD----NIIISQMEHVPWQMLCARVGAELRVIPLNPD--TLQLETLPTLFDAATRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVD---GAQAVMHHP----------DVQALDCDFYVFSGHKL-YGPTGIG-ILYVKEALLQEM----PPWEGGGSMIATVAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLES-VPDLTLYGPQALGVIAFNLGAHHAYDVGSFLDNYGIAVRT-AMPLMAYYNVPAMTHEEVDRLVTGLQRIHRLL...................................................... 405
44 -12.5003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  13  26....................................................................................RELLDYSSNINPLGIGVYPDVN---RRLNKSIENYLKLKDIGIV--LGNGASEIIELSISLFE------------KILIIVPSYAEYEINAKKHGVSVVFSYLDEN-MCIDYEDIISKIDDVDSVIIGN-PNNPNGGLEKFIHVLKLAEEKKKTIIIDEA----FIEFTGDPSSSFVGEIK-NYSCLFIIRAMTKFFAMPGIRFGYGITNNKEIAAKIKAKQNPW---------------NINCFAEMAAINCLKDTNYIEESLLWIKKERKRFIEELNKIGFIKRVFSPHANFVLCRLENISGEKLYDSLLKEDIVIRRCCNFIGLFVRFAIKDEKKNTKFLRALKGVENNL...................................................... 361
45 -12.5004q75_A mol:protein length:429 Cysteine desulfurase 2, chloroplastic  ali model follow..  17  43.......................................DSAATSQKPAAVLDALQNYYEFYNSNVHRGIHYLSAKATDEFELARKKVARFINASDSREIVF-----------------------------TRNATEAINLVAYSWGLSNLKPGD----EVILTVAEHVPWQIVSQKTGAVLKFVTLNEDE-VPDINKLRELISPKTKLVAVHHVSNVLASSLPIEEIVVWAHDVGAKVLVDACQS---VPHMV----------DVQKLNADFLVASSHKM-CGPTGIG-FLYGKSDLLHSEMISDVFLDHSTYAEPPSRFEAGTPAIGEA-AAVDYLSGIGMPKIHEYEVEIGKYLYEKLSS-LPDVRIYGVHRGALCSFNVEGLHPTDLATFLQQHGVAIRS-AQPLHRYLGVNASTKDDVDAFIVALADTVSFFNS.................................................... 427
46 -12.5003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  12  21............................................................................GPRNVGVLTEALQNI--DDNLESDIYAVIEDFETKIAKIL--------GKQSAVFFPSGTMAQQIALRIWADRK------ENRRVAYHPLSHLEIHEQDGLKELQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFD-------SVYVSFYK-GAILAGNDDFVQEAKIWKRR--------YGGDLIS------------LYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVNSADEIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIKNLELVFRCLEKE................................................... 358
47 -12.1003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/th  ali model follow..  10  11.....................................................................QTTGQISGHGKRNVGVLKTAFAAVADEMASDQYAIIEPFEQKFADVL--------GMDDAVFFPSGTMAQQVALRIWSDET------DNRTVAYHPLCHLEIHEQDGLKELHIETILVGAADRLMTLDEIKALPDIACLLL--ELPQREIGAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFD-------SIYISFYK-GAILAGPAAFCQTARIWKRR--------YGGDLIS------------LYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDADISPKLEQVQEETGLGFVGYLVDKDGYCSTISVGDAYGELDQQTRDAGFARLRQA................................................... 355
48 -12.0001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransfe  ali model follow..  11  33......................................................................................................DYNIGVVEQIRQQLTALATASEGYTSVLLQGSGSEAVLGSALGPQDKV----------LIVSNGAYGAMVEMAGLMGIAHHAYDCGEVA-RPDVQAIDAILNADISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDASFGGI--------------PMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIIT-EDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFRI-EVYAADITALLTAIRTAMYWTK..................................................... 366
49 -11.9001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  15  11....................................KLPQLGTT---IFTQMSALAQQHQAINLSQG-------FPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQDADSDITVTAGATEALYAAITALVR--------NGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHKVGYCVAPAPIS---AEIRKVHQYLTFS----------------VNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES............................................................................................................................... 309
50 -11.7004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  12  77.........................................................................LKTPDIVTEAMVDVVRSGKFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWEIITSGVSQAIVLALTALCN--------EGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKWECDLRAAAGMVDSHTKAFVIINPSNPCGSNAHVSDIIDFCQQHQIPLISDEIYAEMVL-----NNGIFTSVADFD-TNVPRLILGGTAKYQVCPGVGWSILIDPMNVAGDWAVGMERLTQLIAGVNS-------ICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISME-APQASMFVMLKLNLSYFQYEKLLDEENVQVEIFGMSGFLRATVSR---------SAVLNEAVDRIIE.................................................... 431
51 -11.6003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  15  11.............................................................................SDTVTQPTDAMRQCMLHAEVGDDVYPGVNALEAYGADLL--------GKEAALFVPSGTMSNLLAVMSHCQRG--------EGAVLGSAAHIYRYESAVLGSVALQPVPMQAD--SLALADVRAAIAPDDV--LVCLENTHNGKVPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFD-------SVSICLSKVGSLLVGSHAFIARARRLRK---------VGG--------GMRQAGILAQA------FALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTSGESAPLLAFMKARGILFSGYGELRLVHLQIHDDDIEEVIDAFTEYLGA.......................................................... 341
52 -11.6002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  13  12.............................................................................SDTVTKPTEEMRKAMAQAEVGDDVYPTINELERLAAETF--------GKEAALFVPSGTMGNQVSIMAHTQRGD--------EVILEADSHI-YEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRSLIAIENTHNRSGGRVENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYAD-------SVMFCLSKVGSVVVGDRDFIERARKARK---------LGG--------GMRQAGVLAAA------IALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS..................................................... 349
53 -11.6001wyt_A mol:protein length:438 glycine dehydrogenase (decarboxylating) subun  ali model follow..  14  4..TPHTEEEIREMLRRVGAASLEDLFAHLPKEILSPPIDPEPLPEWKVLEELRRLAAQNLPAHKAFLGGGVRSHHVPPVVQALAARG-EFLTAYTPYQPEVSQGVLQATFEYQTMIAELAG---EIANASMYDGATEGVLLALRETG----------RMGVLVSQGVHPEYRAVLRAYGAKLLTLPLEGGRTPLP------EVGEEVGAVVVQNPNF-LGALEDLGPFAEAAHGAGLSLGVLKPPGAYGADIAVGDGQSLGLPMGFQLPGLVSETVDVERRGFI-----TLQAREQYIRRAK------------AKSNITTNAQLTALMGAMY-LAALGPEGLREVALKSVEMAHKLHALLLEVPGVRPFTPKPFFNEFALALPK-DPEAVRRALAERATPVPREYGENLALFAATELEEEDLLALREALKEVLA........................................................ 438
54 -11.5003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  14  42......................................................................................................TEFSSTMLENEKFMLEYAKAPEGSKAVFMTCSSTEAVVMNCFTKKDKV----------VIDGGSFGHRFVQLCEIHEIPYVALKLEHGK-KLTKEKLYEYDNQNFTGLLVNVDETSTAVLYDTMMIGEFCKKNNMFFVCDCVSAFLADPF------------NMNECGADVMITGSQKVLACPPGISVIVLAPRGVERVEMYFDLKDALKNQERGQTPFTPAVGILLQINERLKEIKKHGADAEVARIASQAADFRAKIKDLPFEL-VSESPANGVTSVHPTTANAYDIFLKLKDE............................................................................................. 324
55 -11.2003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferas  ali model follow..  11  15...................................................................................TDNPIRINFNENPLGMSPKAQAAARDAMLGNKLAAHHQVEAPSIL--LTAGSSEGIRAAIEAYAS--------LEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDN-WAFDIEGLKAAVAAYS-IVYLVNPNNPTGTITPADVIEPWIASKNTMFIVDEAYAEFV----DPRFRSISPMITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGRYVAG-----------------KINFSGVDAALASMNDSAFITYSKKSNDVSR---QILLKALEDLKLPYLPSEGNFVFHQLVVPLKDYQTHMADAGVLIGRAFPPADNWCRISLGTPQEMQWVADTMREFRKK....................................................... 351
56 -11.2001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  14  60...............................................................................KEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVV--LCSGGSHGILMAITAICD--------AGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNKHVEDIVRLAEELRLPLFSDEIYAGMV--FKGKDPNATFTSVADFETTVPRVILGGTAKNLVVPGLGWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQ------AALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGE-CIGLAPT-MPRGAMYLMSRIDLEKYRFEKLLEEENVQVTIFHAPGFTRLTTTR---------VEVYREAVERIKA.................................................... 408
57 -11.2002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  11  18...........................................................................................ALLRPMRGHLDPEVLRVNRAIQERLAALFDPGEGALVAALAGSGSLGMEAGLA----------NLDRGPVLVLVNGAFSVAEMAALHGLDPEVLDFPPGE-PVDPEAVARALKRRRYRMVALVGETSTGVLNPAEAIGALAKEAGALFFLDATLGMLPFSMRA---------------GVDYAFTGSQKCLSAPPGLAPIAASLEARGKRGWYLDLARVAEHWERGGYHHTTPVLLHYALLEALDLVLEEGVAARERRAREVYAWVLEELKARGFRPYPKASPLPTVLVVRPPEVDADRLVRALYAEGVAVAGGIGPTRLGLMGEGARREAYQAFLKALDRALALA...................................................... 353
58 -11.0004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  6.............................................................................SDTVTRPSRAMLEAMMAAPVGDDVYPTVNALQDYAAELS--------GKEAAIFLPTGTQANLVALLSHCERG--------EEYIVGQAAHNYLFEAAVLGSIQPQPIDAAAD--TLPLDKVAMKIKPDDI--LLSLENTHNGKVEYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKEITQYCD-------SFTICLSKVGSLLVGNRDYIKRAIRWRK---------TGG--------GMRQSGILAAA------YALKNNVARLQEDHDNTAWMAEQLREA------VMRQDTNMLFVRVGEENAAALGEYMKARN--VLINASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR....................................................... 333
59 -11.0001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  12  15.......................................................................PYSFVNDYSVGMHPKILDLMARDNMTQHAGY-GQDSHCAKAARLIGELLERPDADV---FISGGTQTNLIACSLALRPWEA--------VIATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENR-KLVYISNTTEVGTQQELEDISASCKEHGLYLFLDGARLASALSSPVN---------DLTLADIARL-TDMFYIGATKAGGGEALIILNDALKPNARHLIKQRGALMAK--------GWLLGIQFEVL--MKDNLFFELGAHSNKMAAILKAGLEA--CGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEPLKDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS....................................................... 357
60 -10.9003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  16  6.............................................................................SDTVTRPSRAMLEAMMAAPVGDDVYPTVNALQDYAAELS--------GKEAAIFLPTGTQANLVALLSHCERG--------EEYIVGQAAHNYLFEAAVLGSIQPQPIDAAAD--TLPLDKVAMKIKPDDI--LLSLENTHNGKVEYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEITQYCD-------SFTICLSKVGSLLVGNRDYIKRAIRWRK---------TGG--------GMRQSGILAAA------YALKNNVARLQEDHDNAAWMAEQLREA------VMRQDTNMLFVRVGEENAAALGEYMKARN--VLINASPIVRLVTHLDVSREQLAEVAAHWRAFLAR....................................................... 333
61 -10.8003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  13  2................MNFPIDEKLIREKQNELHIKDLGMAS---------IRDLVALVTNLEKATGTKFCRMEMGVPGLPAGIETEIQKLREGVASIYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVANRTHKNREY----GTLFIDPGFNLNKLQCRILGQKFESFDLEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCEELRIIGELATKHDVIVIEDLAYFG--MDFRKDYSHPGEPLYQPSVANYTDALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESFGGEALSSSALYALSSGATHSAQWGMAAMLGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVYDKDGNEPLFTVGYKGMDSSKLIEKFVRYG------KRNEAMRICTSLLPESQFPDLEKRLQMLNAE....................................................... 436
62 -10.6003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  11  5..............................................................KWKKSLAGLSSYKPGKREEEVMAELGLTKITKLSSNENPLGTSKKVAAIQANSSVETEIYPDGWAS-IFTAGVDELIELLTRVLLD--------TTTNTVMATPTFVQYRQNALIEGAEVREIPLLQD-GEHDLEGMLNAIDEKTTIVWICNPNNPTGNYIELADIQAFLDR--VPSDVLVVLDEAYIEYVTPQPEKHEKLVR-TYKNLIITRTFSKIYGLASARVGYGI------ADKEIIRQLNIVRPPFNTTSI----------GQKLAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFEKVKLY--PANGNFVLIDLGIEAGTIFSYLEKNGYITRSLGFPTAVRITIGKEEDN--SAVIALLEKLL......................................................... 363
63 -10.6001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  73..LKKIFHIIDLENKFDATVNAREIETAVNNYEDSILPP--------FFKSLKEYVSRYLIQFDCPGHQGGQYYRKHP-----AGREFYDFFGETVFRADLCNADVALGDAAEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVNNHKSVYNSALAMPVYLQTNRNPYGFIGGIYDSDFDEKKIRELAAKVDPERAKWKRPFRLAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYFIPMMRNSSPLLIDDLGPEDPGIIVVQ-SVHKQQAGFSQTSQIHKKDSHIKGQLRYCDHKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGR-KLWHDLLITTIEARKKLIKA-DNQYYVDPNKFMLTTYEDFGVPATIVANYLRDHGIIPEKSDLNSILFLMTPAETPAKMNNLITQLLQLQRLIEED................................................... 569
64 -10.6002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  16  73......................................................................................................AGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIAN--------PGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFINERTKGIVLSNPCNPTGVVDEMRYLVEIAERHGLFLIVDEVYSEIVFR-------EFASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAM--------------KLAQGRLAPPLLEQIGSVGLLDDSFFDFVRETYRERVETVLKKLEEH--GLKRFTKPSGAFYITDAEEFARWMLTDVAPLRGFYLTPGLGKKEIRIACV-LEKDLLSRAIDVLMEGLKMFCSS................................................... 399
65 -10.6001b9h_A mol:protein length:388 PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHA  ali model follow..  14  13.............................................................................PQYDDAERNGLVRALEQGQWWRMGGDEVNSFEREFAAHH--------GAAHALAVTNGTHALELALQVM----------PGTEVIVPAFTFISSSQAAQRLGAVTVPVDVDAATYNLDPEAVAAAVTPRTKVIM---PVHMAGLMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVG---------ELDSIATFSFQNGKLMTAGEG-GAVVFPDGETEKYETAFLRHSCGRPRDDRRYFHKIAGMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADRNSHYMAMFRI-ALVDRLVEAG--LPAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNTDA-------ISSDCVWLHHRVLLAGEPELHATAEIIADAVARA........... 388
66 -10.5004k2i_A mol:protein length:443 NTD biosynthesis operon protein NtdA  ali model follow..  16  89...........................................................................................TLTEVLPTGKFPYLEQFEKVLSTYL--------HKRYVIATSSGTDAIMIGLLALG---------PGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFIL---PVHLYGKHSDMQHIRQIANRYKLKVIEDACIGL------DLGKYADITTLSF----------PYKNFGVCGKA-GAIATDNEELAKKCIQFSYHGFEVNVKNKKVINFGFNSKMDNLQAAIGLERMKYLSLNNFKRLFLADRYITQLAELQNKGYIEEDHVWHLFPIKVRTEDRADIMTKLNEDFGVQTDVYYPILSHM.............................................................................. 387
67 -10.5002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5`  ali model follow..  10  1...........GAMNPLAQSLNEQLQQSNATAFAMLSLGQNMFYPKGILSQSAEAKSTTYNAT-----IGMATNKDGKMFASSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLR---SIDNMSRPIVTNALTHGLSLVGDLFVN--------QDDTILLPEHNWGNYKLVFNT-GANLQTYPIFDKDGHYTTDSLVEALQKDKVIMILNYPNNPTGYTKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTTALTNLHSNAILPIRLDGATKEFFAWGF---GFMTFGTSDQTTKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTLKERYEVTKEVVYADQYHS--HWQAYDFNSGYFMAIKVHDVDPEALRKHLIDKYSIGVIALNATDIRIAFSCVEKDDIPHVFDSIAKAIDDLR..................................................... 430
68 -10.5003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  13  64.........................................................................LPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCPEAPLEAKD-----ILTSGCSQAIDLCLAVLAN--------PGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVRHLQKILAVAARQCVPILADEIYGDMVFS-----DCKYEPLATLS-TDVPILSCGGLAKRWLVPGLGWILIHDRRDIFGNEIRD-----GLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAA-IPGLRPV-RPSGAMYLMVGIEMEHFPTERLVAEQSVHCTCFEYPNFIRVVITVPEVMMLEAC................................................................. 408
69 -10.4002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotrans  ali model follow..  12  6....................................RLRPYA---TTVFAEMSALATRIGAVNLGQG-------FPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDDPETEVLVTVGATEAIAAAVLGLVE--------PGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGFALDADALRRAVTPRTRALIINSPHNPTGAVTELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSFNCTGWKIGWACGPAELI---AGVRAAKQYLSYV----------------GGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI--GFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCHLVRFTFCKRDDTLDEAIRRLSVLAERPATGVPRG........................................... 403
70 -10.3003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  12  47.........................................................................LPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCPEAPLEAKD-----ILTSGCSQAIELCLAVLAN--------PGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKWEIDLKQLESLIDEKTACLVVNNPSNPCGSVRHLQKILAVAERQCVPILADEIYGDMVF-----SDCKYEPMATLS-TNVPILSCGGLAKRWLVPGLGWILIHDRRDIFGNEIRD-----GLVKLSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNADLCYGALSA-IPGLQPV-RPSGAMYLMVGIEMEHFPTERLIAEQSVHCTCFEYPNFFRVVITVPEVMMLEAC................................................................. 391
71 -10.2005dj1_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  10  85.................................................................................................................................LSCYSSSVSMEILARSLSA--------SVDRVALVHPTFDNIADLLRGNGLDLVPVEEDA----LHGADLSAELLSSVGCVFVTTPNNPTGRVERLRRLAEQCAEHGTVLALDTSFRG----FDAAAHYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVE----------IYSDILLGVSPLILALIREFS--RDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVERVAFAGRTGTEVWEELQRHHVFALPWAEPSDGDHMVRIALSRSTEPLEKSVQVLRTVLETR................................................... 376
72 -10.1002x3l_A mol:protein length:446 ORN/LYS/ARG DECARBOXYLASE FAMILY PROTEIN  ali model follow..  11  41................................................................................................MDKTEIPGLDDLHEEVILKSMKQVEKHSDYDGYFLVNGTTSGILSVIQSFSQ--------KKGDILMARNVHKSVLHALDISQQEGHFIETHQSPLTNHYNKVNLSRLNND-LVVLTYPNY-YGETFNVEEVIKSLHQLNIPVLIDEAHGAHF-------GLQGFPDSTLNY-QADYVVQSFHKTLPALTMGSVLYIHKNAPYRENIIEYLSYFQTSSPSYLIMAS-----LESAAQFYKTYDSTLFFAKRAQLIECLENKGFEMLQVDDPLKLL---------IKYEGFTGHDIQNWFMNAHIYLE-LADDYQALAILPLWHHDDTYLFDSLLRKIEDMILPKKSVSKVKQTQLKRFEYVTWCDLKKAKGKVLARHI................. 399
73 -10.1001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  14  12.............................................ESIFPRMSGLAQRLGAVNLGQGFPS---NPPPPFLLEAVRRALG--------RQDQYAPPAGLPALREALAEEFAVEPES----VVTSGATEALYVLLQSLVG--------PGDEVVVLEPFFDVYLPDAFLAGAKARLVRLTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVRELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFAPERTFTVGSAKRLEATGYRVGWIVGPKEFM---PRLAGMRQWTSFS--------------APTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAM--GLRVYVPEGTYFLMAELPGWDAFRLVEEARVALIPASAFYLEDPPKDLFRFAFCKTEEE----LHLALERLGRVVNSPREAEGGAV....................................... 379
74 -10.1003ele_A mol:protein length:398 Amino Transferase  ali model follow..  10  16.................................................SAIRELFEYGKKRAAIVGKENVYDFSIGNP-QIVNDTIKELVTDYDSVALHGYQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTS--------AYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEHFQIDFDALEERINAHTRGVIINSPNNPSGTVETIKKLSDLLEKKSKEIYREIVYDGIKVPFVTKYYDNTLVCYSYS----KSLSLPGERIGYVLVPDEVYDKAE-----------------LYAAVCGAGRALGYVCAPSLFQKMIVKCQGATGDINAYKENRDLLYEGLTRI--GYHCFKPDGAFYMFVKALEDDSNAFCEKAKEEDVLIDGFGCPGWVRISYC-VDREMIKHSMPAFEKIYKKYNK.................................................... 398
75 -9.9603nys_A mol:protein length:367 Aminotransferase WbpE  ali model follow..  15  21...........................................................................................GIQRVLRHGQYPEVTELEDRLADFV--------GAKYCISCANGTDALQIVQMAL----------PGDEVITPGFTYVATAETVALLGAKPVYVDIDPRTYNLDPQLLEAAITPRTKAII---PVSLYGQCADFDAINAIASKYGIPVIEDAAQSGASYKGKRSCNLSTVACTSF--------SAPLGCYG----DGGAIFTNDDELATAIRQIARHGQDRRYHHIRVGVNSRLDTLQAAILLPKLEIFEEEIALRQKVAAEYDLSLKQVGIGTPFIEVNNISVYAQYTVRMDNRE--SVQASLKAAG---TAVHYPIPLNKQPAVADEKAKLPVGDKAATQVMSLPMHP.................................................. 343

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.