current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3ltf_D mol:protein length:58 Protein spitz, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
1 -30.4003ltf_D mol:protein length:58 Protein spitz  ali model  100  1TFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPK 58
2 -19.7003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  31  2TSHLVKCAEKE-KTFCVNGGECFMVKDLSNSRYLCKCPNEFTGDRCQNYVMASF.... 55
3 -19.5001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  32  2VSHFNDCPLSH-DGYCLHDGVCMYIEALD--KYACNCVVGYIGERCQYRDLKWWEL.. 54
4 -19.3001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  28  9........AEKEKTFCVNGGECFMVKDLSNSRYLCKCQPGFTGARCTENVPMKVQNQ. 58
5 -18.6001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  33  2..SDSECPLSH-DGYCLHDGVCMYIEALD--KYACNCVVGYIGERCQYRDLKWWEL.. 52
6 -17.1001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  32  7........PSSYDGYCLNGGVCMHIESLD--SYTCNCVIGYSGDRCQTRDLRWWEL.. 52
7 -16.8001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  34  7........PSSYDGYCLNGGVCMHIESLD--SYTCNCVIGYSGDRCEHADLLA..... 49
8 -16.6005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  27  29QVSITKCSSDM-NGYCLHGQCIY---LVDMSQNYCRCEVGYTGVRCEHFFL....... 75
9 -16.0001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  30  4........PSSYDGYCLNGGVAMHIESLD--SYTCNCVIGYSGDRCQTRDLR...... 45
10 -15.8002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  33  146......CQQAECPGGCRNGGFCN-------ERRICECPDGFHGPHCEGT......... 181
11 -15.6001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  29  36..KRDPCLRKY-KDFCIH-GECKYVK--ELRAPSCICHPGYHGERCHGLS........ 79
12 -14.6001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  24  2VSHFNDCPDSH-TQFCFHGTCRFLVQE---DKPACVCHSGYVGARCEHADLLA..... 50
13 -14.0001iox_A mol:protein length:50 Betacellulin  ali model follow..  27  2KGHFSRCPKQY-KHYCIKGRCRF---VVAEQTPSCVCDEGYIGARCERVDLF...... 49
14 -13.8004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  21  46........QACRTNPCLHGGRC----LEVEGHRLCHCPVGYTGPFCDVDT........ 83
15 -13.7001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  36  48........DQCEGHPCLNQGHC----KDGIGDYTCTCAEGFEGKNCEFST........ 85
16 -13.4001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  25  49........KSCSEPRCFNGGTCQ--QALYFSDFVCQCPEGFAGKSCEIDT........ 88
17 -13.4002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  24  6SGKKNPCNAEF-QNFCIH-GECKYIE--HLEAVTCKCQQEYFGERCGEK......... 50
18 -13.1003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  28  186....TTCQE----DSCSNQGVC----LQQWDGFSCDCSTSFSGPLCNDPG........ 224
19 -13.1001fax_L mol:protein length:96 FACTOR XA  ali model follow..  31  5........DQCETSPCQNQGKC----KDGLGEYTCTCLEGFEGKNCELFT........ 42
20 -12.8001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  21  4.VDGDQCLEHPCASLCCGHGTC----IDGIGSFSCDCRSGWEGRFCQREVSFLNCSLD 60
21 -12.7002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  30  98.YIGTHCGQPVCESGCLNGGRCV-------APNRCACTYGFTGPQCE........... 136
22 -12.4004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  16  139.FKSQQADGGGSSAPWHNGGVWVIKTLNGNMTYAGEGPIGFKGNSVAGNN........ 214
23 -12.4001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  31  49........DQCEPNPCLNGGLC----KDDINSYECWCQVGFEGKNCELDATCNIKNG. 93
24 -12.3004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  16  188.WTGKYCDQPICSGCHEQNGYCS-------KPDECNCRPGWQGPLCNEAA........ 230
25 -12.1004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  16  128.FKSEVTDGDGSAAPWHSGGVWVL--LSGTMTYNGEGPIGFRGTLTSPDT........ 204
26 -12.0001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  30  43........DQCETSPCQNQGKC----KDGLGEYTCTCLEGFEGKNCELFTRK...... 82
27 -12.0001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  30  48........DQCETSPCQNQGKC----KDGLGEYTCTCLEGFEGKNCELFTRK...... 87
28 -11.9004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  37  7........DQCESNPCLNGGSC----KDDINSYECWCPFGFEGKNCE........... 41
29 -11.8003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  22  436GWEGDFCRTAKCEPACRHGGVCVRPN-------KCLCKKGYLGPQCE........... 475
30 -11.8004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  24  257.WGGQLCDKDLNHQPCLNGGTCSN---TGPDKYQCSCPEGYSGPNCEIVD........ 306
31 -11.7004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  23  33.YTGPRCENECISNPCQNDATC----LDQIGEFQCICMPGYEGVYCEINTDECASSP. 87
32 -11.6001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  26  48........DQCASSPCQNGGSC----KDQLQSYICFCLPAFEGRNCETHKDDQLICV. 92
33 -11.6001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  27  4........DQCASSPCQNGGSC----KDQLQSYICFCLPAFEGRNCETHKDDGSA... 46
34 -11.4001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  28  1.......TASCQDMSCSKQGEC----LETIGNYTCSCYPGFYGPECEYVR........ 39
35 -11.4004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  33  88.FNGIHCQNECEVEPCKNGGIC----TDLVANYSCECPGEFMGRNCQYKG........ 135
37 -11.2004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  17  187.WTGKYCDQPICSGCHEQNGYCS-------KPDECNCRPGWQGPLCNE.......... 227
38 -11.1005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  21  5........DPCASNPCANGGQC----LPFEASYICHCPPSFHGPTCRQDVNECGQKPG 50
39 -11.0002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  19  237.LEGEQCEISKCPQPCRNGGKCI-------GKSKCKCSKGYQGDLCSKPVCEPGC... 283
40 -11.0003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  25  181SGGGSPCEEEGEGGVCLNGGVC----SVVDDQAVCDCSTGFRGKDCSQG......... 228
41 -10.8005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  21  1.......QDPCASNPCANGGQC----LPFEASYICHCPPSFHGPTCRQDVNECGEKPG 47
42 -10.8002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  20  333TSGALLCSQAL----CSGHGRCVRRTSHPKVEFKCRCYPGWQAPWCERK......... 413
43 -10.7005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  26  2....NPC----CSHPCQNRGVCMS---VGFDQYKCDCTTGFYGENCSTPEFLTRI... 46
44 -10.6004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  23  453.YTGRNCSSRCEHAPCHNGATCH----QRGHGYVCECARSYGGPNCQFLLPELPPGP. 507
45 -10.4003cfw_A mol:protein length:164 L-selectin  ali model follow..  25  117......CYTASCQWSCSGHGEC----VEIINNYTCNCDVGYYGPQCQF.......... 155
46 -10.2001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  25  34....NPC----CYYPCQHQGICVR---FGLDRYQCDCTTGYSGPNCTIP......... 72
47 -10.2002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  26  116.WGGQLCDKDLTHQPCLNGGTCSN---TGPDKYQCSCPEGYSGPNCE........... 162
48 -10.1005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  19  268.IYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQ........... 313
49 -9.3903h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  26  5...GSPCI----SQPCLHNGSC----QDSIWGYTCTCSPGYEGSNCELAKNEC..... 46

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.