current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst GEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRLast
1 -100.0003i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model  100  1GEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRR 220
2 -71.5004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  44  7.EPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQ-CWRLFNNSRCDPACSSPACLYDNFDCHGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHRPSPGSEPRARRELAPEVI------GSVVMLEIDNRLCLQSPEN 220
3 -70.9003eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  98  1GEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGMD......................................... 179
4 -70.5003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  88  1.GSACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGDVR---------------------GSIVYLEIDNRQCVQASSQ 198
5 -69.8002oo4_A mol:protein length:234 Neurogenic locus notch homolog protein 2  ali model follow..  49  1.GATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWD-YINNQCDELCNTVECLFDNFECQGNSKTCK--YDKYCADHFKDNHCNQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEVA---------------------GSKVFLEIDNRQCVQDSDH 195
6 -24.2002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  18  143.FKTCQQAECPGGCNGGFCRRICECPD-GFHGPHCEKALCTP--RCMNGCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGCPQPCRNGGKCGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCH....................................................................................... 290
7 -18.4004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  18  150.........CSDNYYGDSCSRLCKKRDDHFGHYECQP---------DGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSKPECNCRPGWQGIPHKGCRHGTCTIP-CACDEGWGGLFCDQAAA.................................................................................................. 261
8 -17.1004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  21  151.........CSDNYYGDSCSRLCKKRDDHFGHYECQP---------DGSPSCLPGWTGKYCDQPICLSGCHEQNGYCSK------------------PDEC-----NCRPGWQGPLCNEAA................................................................................................... 230
9 -17.1005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  18  202GFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVC----GQCLCHTSDVPGKL-IYGQYCECDTINCERYNGQVC-GGPGRGLCFCGKCRCHPGFEGSACQ...................................................................................................... 313
10 -15.7004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  18  195.GPECNHL-CTACMNNGVCHGECICPP-GFMGRTCEKEGCKSYVFCPYGCSCATGWKGLQCNEACHP---GFYGPDCKLR-------------SCNNGEMCDR--CLCSPGWQGLQCEREGIP................................................................................................. 324
11 -15.2004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  12  156.........CDDYYYGFGCNKFCRPRDDFFGHYACDQ---------NGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPDCRCQYGWQGIPHPGCVHGICNEP-CLCETNWGGQLCDKDLTHQPCLNGGTCS....................................................................................... 282
12 -12.7002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  13  179.............QVLPQCE--CRCRDQSRDRSLCHGKG-----FLECGCRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNS---------IICSGLGDCVCGQCLCHTSIYGQYCE...................................................................................................... 274
13 -11.3002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  12  15.........CDDYYYGFGCNKFCRPRDDFFGHYACDQ---------NGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPDCRCQYGWQGIPHPGCVHGICNEPQCLCETNWGGQLCDKDLTHQPCLNGGTCS....................................................................................... 141
14 -10.2002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  19  34GGNQCIVPICRHSCGDGFCPNMCTCPS-GQIAPSCGSRSIQHCNICMNGCLCQKGYIGTHCGQPVCESGC-------------------------LNGGRCAPNRCACTYGFTGPQCE...................................................................................................... 136
15 -10.1002ddu_A mol:protein length:387 reelin  ali model follow..  12  191......SEPCPSYCGHGDCSGVCFCDL-GYTAAQGTCVSNTPNHS-PLWYKITGGQVGTGCGTLNDGRSLYFNGLGKRE----------RTVPLDTRNIRLVQFYIQIGSKTSGITCIKPRARNE--------LVVQYSNDNGILWHLLRELDFMSFLEIDLPREAKTPATAFRWWQPQHGKHSA................................... 369
16 -10.1004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  134........EGPIGFKSQQADGGGSSAPWH-NGGVWVIGARDQAVVAVSAGEGPIGFKGNSVAGNGTSAPWH-PGGIWLLG-CRSGQNVVELYITSGDNGNTFHGSMTYSGGFRAMALPQ..................................................................................................... 279
17 -9.5804fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  51MTYNGE---GPIGFRGTLSSANGTSAPWQ-PGGVWVLGASNDGGKTLTGGEGPIGFKSEVTDGDGSAAPWH-SGGVWVLG-TRGKQNVINVDAKSNDGGKTLSGTMTYNGGFRGTLTSPDT................................................................................................... 204
18 -9.3604xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  19  310..DECDPSPCKNGGS--TCPPGFYGKICELSAMTCADGPCFNGGRCSDSCRCPVGYSGFNCEDYCSSSPCS-NGAKCVDLGDACDDNVDDCASSCANGGTCRDGVNDFSCGYTGRNCSAPVEHAPCHNGATCH....................................................................................... 477
19 -9.2705ch1_B mol:protein length:937 putative polycomb protein Ezh2,putative polyc  ali model follow..  14  507.ANGCP---CSAGTHPVLCERFCLCTACPFTGCACHSSGKTCLQRQREGRPCICVQLNRECDPTLCK-GCGARERADPENAYDEVLHSTGCQNVALQRGAAKAKSQLEACGYGGELISHDEGVRREHRRGDVFDEENKVSYYGNLSRYINHVNHEWRIKFTAIKDKAGEELFFNYGDNFPNLTKKLVERNEQSGAETTPQQPKRANGLVPRGSEVMLPGR 776
20 -9.1205ij7_A mol:protein length:643 Enhancer of Zeste Homolog 2 (EZH2),Histone-ly  ali model follow..  17  425...QPCDNSCPCVIAQNFCEKFC---------------------QCSSE--CQNRFPGCRCKAQCNTKQC------CYLAVRECDP------------DLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLA-------------------SDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIR. 582

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;