current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3h5c_B mol:protein length:317 Vitamin K-dependent protein Z, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst RYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMNLast
1 -128.0003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model  100  1RYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN 317
2 -112.0003f1s_B mol:protein length:283 Vitamin K-dependent protein Z  ali model follow..  100  1.........................................AKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYSLWFKQIMN 276
3 -106.0004bxs_A mol:protein length:423 FACTOR X-LIKE PROTEASE  ali model follow..  31  43VYVDGDQCSSNPCHYRGICKDGIGSYTCTCLSGYEGKNCERVLYKSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRRIVNGMDCKLGECPWQAALVDEKEGVFCGGTILSPIYVLTAAHCINETETISVVVGEIDKSETGPLLSVDKIYVHKKFDLAAYDYDIAIIQMKTPIQFSENVVPACLPTADFANQVLMKQDFGIVSGFGREKGPKSKTLKVLKVPYVDRHTCMVSSETPITPNMFCAGLPRDACQGDSGGPHTTVYRDTHFITGIVSSGGCARNGKYGNYTKLSKFIPWIKRIMR 410
4 -97.7001c5m_D mol:protein length:255 PROTEIN (COAGULATION FACTOR X)  ali model follow..  24  1.............................................................................................IVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGREKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGGCARKGKYGIYTKVTAFLKWIDRSMK 233
5 -97.7002bq6_B mol:protein length:249 FACTOR XA  ali model follow..  23  14...........................................................................................TRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGREKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGGCARKGKYGIYTKVTAFLKWIDRSMK 248
6 -97.2001kig_H mol:protein length:241 FACTOR XA  ali model follow..  27  1.............................................................................................IVGGRDCAEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEGNEMAHEVEMTVKHSRFVKETYDFDIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIVSGFGREKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPNMFCAGQPEDACQGDSGGPHVTRFKDTYFVTGIVSWGGCARKGKFGVYTKVSNFLKWIDKIMK 233
7 -94.5001aut_C mol:protein length:250 ACTIVATED PROTEIN C  ali model follow..  27  1.............................................................................................LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERLNQAGQETLVTGWGYHSSRRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGGCGLLHNYGVYTKVSRYLDWIHGHIR 239
8 -94.2004ylq_H mol:protein length:249 Coagulation factor VII  ali model follow..  24  1.............................................................................................IVGGKVCPKGECPWQVLLLV-NGAQLCGGTLINTIWVVSAAHCFDNWRNLIAVLGEHDLDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQDRGATALELMVLNVPRLMTQDCEASFPGKITEYMFCAGGSKDSCKGDSGGPHATHYRGTWYLTGIVSWGGCATVGHFGVYTRVSQYIEWLQKLMR 235
9 -92.5002wph_S mol:protein length:235 COAGULATION FACTOR IXA HEAVY CHAIN  ali model follow..  25  1.............................................................................................VVGGEDAKPGQFPWQVVL-NGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEHTEQKRNVIRIIPHHNFNANTYNHDIALLELDEPLVLNSYVTPICIADKEYTN-IFLKFGSGYVSGWGRHKGRSALVLQYLRVPLVDRATCLRSTKFTITNNMFCAGGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGECAMKGKYGIYTKVSRYVNWIKEKTK 233
10 -92.4001rfn_A mol:protein length:235 PROTEIN (COAGULATION FACTOR IX)  ali model follow..  25  1.............................................................................................VVGGEDAKPGQFPWQVVL-NGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEHTEQKRNVIRIIPHHNYNANKYNHDIALLELDEPLVLNSYVTPICIADKEYTN-IFLKFGSGYVSGWGRHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGECAMKGKYGIYTKVSRYVNWIKEKTK 233
11 -92.3001pfx_C mol:protein length:235 FACTOR IXA  ali model follow..  27  1.............................................................................................IVGGENAKPGQFPWQVLL-NGKIDAFCGGSIINEKWVVTAAHCIEPGVKITVVAGEYNTEPTEQRRNVIRAIPHHSYNATVYSHDIALLELDEPLTLNSYVTPICIADKEYTN-IFLKFGSGYVSGWGRNRGRSATILQYLKVPLVDRATCLRSTKFTIYSNMFCAGGGKDSCQGDSGGPHVTEVEGTSFLTGIISWGECAVKGKYGIYTKVSRYVNWIKEKTK 233
12 -91.3003ela_H mol:protein length:254 Coagulation factor VIIA heavy chain  ali model follow..  24  1.............................................................................................IVGGKDCPKGECPWQVLLLV-NGAQLCGGTLINTIWVVSAAHCFDKWRNLIAVLGEHDLDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQDRGATALVLQVLNVPRLMTQDCLQQSSPNITEYMFCAGGSKDSCKGDSGGPHATHYRGTWYLTGIVSWGGCATVGHFGVYTRVSQYIEWLQKLMR 240
13 -91.0001cvw_H mol:protein length:254 COAGULATION FACTOR VIIA (HEAVY CHAIN) (DES-GL  ali model follow..  24  1.............................................................................................IVGGKVCPKGECPWQVLLLV-NGAQLCGGTLINTIWVVSAAHCFDKWRNLIAVLGEHDLDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQDRGATALELMVLNVPRLMTQDCLQQSSPNITEYMFCAGGSKDSCKGDSGGPHATHYRGTWYLTGIVSWGGCATVGHFGVYTRVSQYIEWLQKLMR 240
14 -89.7005JDU Entity 2(prereleased)  ali follow..  22  1.............................................................................................IVEGSDAEIGMSPWQVMLFKSPQELLCGASLISDRWVLTAAHCLLTENDLLVRIGKHSRTNIEKISMLEKIYIHPRYNRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGKRGAACEGDSGGPFVMKFNNRWYQMGIVSWGGCDRDGKYGFYTHVFRLKKWIQKVID 255
15 -89.4001vr1_H mol:protein length:261 thrombin  ali model follow..  21  1.............................................................................................IVEGSDAEIGMSPWQVMLFAKHERFLCGASLISDRWVLTAAHCLLTENDLLVRIGKHSRTNIEKISMLEKIYIHPRYNRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAYKRGDACEGDSGGPFVMKFNNRWYQMGIVSWGGCDRDGKYGFYTHVFRLKKWIQKVID 259
16 -89.4003r3g_B mol:protein length:259 Thrombin Heavy Chain  ali model follow..  21  1.............................................................................................IVEGSDAEIGMSPWQVMLFKSPQELLCGASLISDRWVLTAAHCLLTENDLLVRIGKHSRTNIEKISMLEKIYIHPRYNRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLRETQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGKRGDACEGDSGGPFVMKFNNRWYQMGIVSWGGCDRDGKYGFYTHVFRLKKWIQKVID 255
17 -89.0002od3_B mol:protein length:259 Thrombin heavy chain  ali model follow..  21  1.............................................................................................IVEGSDAEIGMSPWQVMLFKSPQELLCGASLISDRWVLTAAHCLLTENDLLVRIGKHSRTNIEKISMLEKIYIHPRYNRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGKRGDACEGDSGGPFVMKFNNRWYQMGIVSWGGCDRKGKYGFYTHVFRLKKWIQKVID 255
18 -88.9001mkw_K mol:protein length:308 PRETHROMBIN-2  ali model follow..  20  1.............................................TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKEFESYIEGRIVEGQDAEVGLSPWQVMLFKSPQELLCGASLISDRWVLTAAHCLLTVDDLLVRIGKHSRTKVEKISMLDKIYIHPRYNKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGKRGDACEGDSGGPFVMKYNNRWYQMGIVSWGGCDRDGKYGFYTHVFRLKKWIQKVID 304
19 -88.8001jwt_A mol:protein length:305 Prothrombin  ali model follow..  19  1..................................................TFGSGEADCGLRPLFEKKSLEDKTERELLES-------YIDGRIVEGSDAEIGMSPWQVMLFKSPQELLCGASLISDRWVLTAAHCLLTENDLLVRIGKHSRTNIEKISMLEKIYIHPRYNRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGKRGDACEGDSGGPFVMKFNNRWYQMGIVSWGGCDRDGKYGFYTHVFRLKKWIQKVID 291
20 -88.6002ocv_B mol:protein length:259 Thrombin  ali model follow..  22  1.............................................................................................IVEGWDAEKGIAPWQVMLFKSPQELLCGASLISDRWVLTAAHCILTENDLLVRIGKHSRTNVEKISMLEKIYVHPRYNRENLDRDIALLKLKKPVPFSDYIHPVCLPDKQTVTSLLRAGYKGRVTGWGNLRETQPSVLQVVNLPIVERPVCKASTRIRITDNMFCAGKRGDACEGDSGGPFVMKFNNRWYQMGIVSWGGCDRKGKYGFYTHVFRLKAWIQKVID 255
21 -88.5003edx_B mol:protein length:258 Thrombin heavy chain  ali model follow..  22  1.............................................................................................IVEGWDAEKGIAPWQVMLFKSPQELLCGASLISDRWVLTAAHCILTENDLLVRIGKHSRTNVEKISMLEKIYVHPRYNRENLDRDIALLKLKKPVPFSDYIHPVCLPDKQTVTSLLRAGYKGRVTGWGNLRETQPSVLQVVNLPIVERPVCKASTRIRITDNMFCAGKRGDACEGDSGGPFVMKFNNRWYQMGIVSAGGCDRKGKYGFYTHVFRLKRWIQKVID 255
22 -88.0001h8d_H mol:protein length:260 THROMBIN  ali model follow..  21  1.............................................................................................IVEGSDAEIGMSPWQVMLFKSPQELLCGASLISDRWVLTAAHCLLTENDLLVRIGKHSRTNIEKISMLEKIYIHPRYNRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNKETGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGKRGDACEGDSGGPFVMKFNNRWYQMGIVSWGGCDRDGKYGFYTHVFRLKKWIQKVID 248
23 -85.9001eaw_A mol:protein length:241 SUPPRESSOR OF TUMORIGENICITY 14  ali model follow..  19  1.............................................................................................VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYSDPTQWTAFLGLHDQAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPD---ASHVFPAGKAIWVTGWGQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGGGVDSCQGDSGGPLSSVEDGRIFQAGVVSWGGCAQRNKPGVYTRLPLFRDWIKENTG 240
24 -85.4002any_A mol:protein length:241 plasma kallikrein, light chain  ali model follow..  22  1.............................................................................................IVGGTESSWGEWPWQVSLQLTAQRHLCGGSLIGHQWVLTAAHCFDGQDVWRIYSGILELSDDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLEYTEFQKPISLPS---KGDTSTIYTNCWVTGWGKEKGEIQNILQKVNIPLVTNEECQKRYDYKITQRMVCAGGGKDACKGDSGGPLVCKHNGMWRLVGITSWGGCARREQPGVYTKVAEYMDWILEKTQ 236
25 -85.3002anw_A mol:protein length:241 plasma kallikrein, light chain  ali model follow..  22  1.............................................................................................IVGGTNSSWGEWPWQVSLQLTAQRHLCGGSLIGHQWVLTAAHCFDGQDVWRIYSGILNLSDDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPS---KGDTSTIYTNCWVTGWGKEKGEIQNILQKVNIPLVTNEECQKRYDYKITQRMVCAGGGKDACKGDSGGPLVCKHNGMWRLVGITSWGGCARREQPGVYTKVAEYMDWILEKTQ 236
26 -85.0004na7_A mol:protein length:244 Coagulation factor XI  ali model follow..  22  1.............................................................................................IVGGTASVRGEWPWQVTLHTTSQRHLCGGSIIGNQWILTAAHCFESPKILRVYSGILNQSEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPICLPS---KGDRNVIYTDCWVTGWGKLRDKIQNTLQKAKIPLVTNEECQKRYGHKITHKMICAGGGKDACKGDSGGPLSCKHNEVWHLVGITSWGGCAQRERPGVYTNVVEYVDWILEKTQ 236
27 -84.9001zhm_A mol:protein length:238 coagulation factor XI  ali model follow..  21  1.............................................................................................IVGGTASVRGEWPWQVTLHTTSQRHLCGGSIIGNQWILTAAHCFESPKILRVYSGILNQAEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYADSQRPICLPS---KGDRNVIYTDCWVTGWGKLRDKIQNTLQKAKIPLVTNEECQKRYGHKITHKMICAGGGKDACKGDSGGPLSCKHNEVWHLVGITSWGGCAQRERPGVYTNVVEYVDWILEKTQ 236
28 -84.4002f91_A mol:protein length:237 hepatopancreas trypsin  ali model follow..  19  1.............................................................................................IVGGTDATLGEFPYQLSFQETFSFHFCGASIYNENYAITAGHCVYNPSGLQIVAGELDNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPEQGHT-----ATGDVIVTGWGSEGGNTPDVLQKVTVPLVSDEDCRADYGDEILDSMICAGGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGGCARPGYPGVYTEVSYHVDWIKANA. 236
29 -83.9001ekb_B mol:protein length:235 ENTEROPEPTIDASE  ali model follow..  17  1.............................................................................................IVGGSDSREGAWPWVVALYF-DDQQVCGASLVSRDWLVSAAHCVMEPSKWKAVLGLHMASNQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPE---ENQVFPPGRICSIAGWGIYQGSTADVLQEADVPLLSNEKCQQQMEYNITENMVCAGGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGQCALPNRPGVYARVPRFTEWIQSFLH 235
30 -83.8001lto_A mol:protein length:245 alpha tryptase I  ali model follow..  20  1.............................................................................................IVGGQEAPRSKWPWQVSLRDRYWMHFCGGSLIHPQWVLTAAHCLKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPP---ASETFPPGMPCWVTGWGDVDNDPPFPLKQVKVPIMENHICDAKYHLIIRDDMLCAGSQRDSCKGDSGGPLVCKVNGTWLQAGVVSWDGCAQPNRPGIYTRVTYYLDWIHHYVP 242
31 -83.7002f9n_A mol:protein length:245 alpha I tryptase  ali model follow..  20  1.............................................................................................IVGGQEAPRSKWPWQVSLRDRYWMHFCGGSLIHPQWVLTAAHCVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPP---ASETFPPGMPCWVTGWGDVDNDPPFPLKQVKVPIMENHICDAKYHLGIRDDMLCAGSQRDSCQGDSGGPLVCKVNGTWLQAGVVSWGGCAQPNRPGIYTRVTYYLDWIHHYVP 242
32 -83.7004dgj_A mol:protein length:235 Enteropeptidase catalytic light chain  ali model follow..  18  1.............................................................................................IVGGSDAKEGAWPWVVGLYY-DDRLLCGASLVSSDWLVSAAHCVLEPSKWTAILGLHMKSNQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPISLPE---ENQVFPPGRNCSIAGWGVYQGTTADILQEADVPLLSNERCQQQMEYNITENMICAGGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGECALPNRPGVYARVSRFTEWIQSFLH 235
33 -83.6002bm2_A mol:protein length:245 HUMAN BETA2 TRYPTASE  ali model follow..  20  1.............................................................................................IVGGQEAPRSKWPWQVSLRVHGPMHFCGGSLIHPQWVLTAAHCVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPP---ASETFPPGMPCWVTGWGDVDNDEPFPLKQVKVPIMENHICDAKYHLGVRDDMLCAGTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGGCAQPNRPGIYTRVTYYLDWIHHYVP 242
34 -83.5004hzh_A mol:protein length:533 Prothrombin  ali model follow..  17  161DFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEEADCGLRPLFEKKSLEDKTERELESYIDGRIVEGSDAEIGMSPWQVMLFKSPQELLCGASLISDRWVLTAAHCLLTENDLLVRIGKHSRTNIEKISMLEKIYIHPRYNRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGKRGDACEGDAGGPFVMKFNNRWYQMGIVSWGGCDRDGKYGFYTHVFRLKKWIQKVID 529
35 -83.3003dfj_A mol:protein length:263 Prostasin  ali model follow..  23  1.............................................................................................ITGGSSAVAGQWPWQVSIT-YEGVHVCGGSLVSEQWVLSAAHCFHHKEAYEVKLGAHQLSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPA---ANASFPNGLHCTVTGWGHVAPSTPKPLQQLEVPLISRETCNALYNIFVQEDMVCAGGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGACGARNRPGVYTLASSYASWIQSKVT 242
36 -82.9003w94_A mol:protein length:235 Enteropeptidase-1  ali model follow..  20  1.............................................................................................VVGGVNAEKGAWPWMVSLHW-RGRHGCGASLIGRDWLLTAAHCVTHLQYWSAVLGLHAQSSEVQIRQVDRIIINKNYNRRTKEADIAMMHLQQPVNFTEWVLPVCLAS---EDQHFPAGRRCFIAGWGAEGGSLPDILQEAEVPLVDQDECQRLLEYTFTSSMLCAGGGVDSCQGDSGGPLMCLEDARWTLIGVTSFGGCGRPERPGAYARVSAFTSWIAETRR 235
37 -82.8002oq5_A mol:protein length:232 Transmembrane protease, serine 11E  ali model follow..  20  1.............................................................................................IVGGTEVEEGEWPWQASLQW-DGSHRCGATLINATWLVSAAHCFTNPARWTASFGVT-IKPSKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPD---ASYEFQPGDVMFVTGFGKNDGYSQNHLRQAQVTLIDATTCNEAYNDAITPRMLCAGGKTDACQGDSGGPLVSSDRDIWYLAGIVSWGECAKPNKPGVYTRVTALRDWITSKTG 231
38 -82.8003e0n_B mol:protein length:271 Prostasin  ali model follow..  23  1.............................................................................................ITGGSSAVAGQWPWQVSIT-YEGVHVCGGSLVSEQWVLSAAHCFPSKEAYEVKLGAHQLSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPA---AQASFPNGLHCTVTGWGHVAPSTPKPLQQLEVPLISRETCNSLYNIFVQEDMVCAGGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGACGARNRPGVYTLASSYASWIQSKVT 242
39 -81.9001qrz_A mol:protein length:246 PLASMINOGEN  ali model follow..  21  13.........................................................................................CPGRVVGGCVAHPHSWPWQVSLRTRFGQHFCGGTLISPEWVLTAAHCLEKPSSYKVILGAHQEEPHVQEIEVSRLFLEPTR------KDIALLKLSSPAVITDKVIPACLPS---PNYMVADRTECFITGWGEQGTFGAGLLKEAQLPVIENKVCNRYLNGRVQSTELCAGGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGGCARPNKPGVYVRVSRFVTWIEGVLR 244
40 -81.9003i78_A mol:protein length:229 Trypsin  ali model follow..  18  1.............................................................................................VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSNNTSITATGGVVDLQSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQ-----PTLKI----ATTTAYNQGTFTVAGWGREGGSQQRYLLKANVPFVSDAACRSSSSFLVANEMICAGKQEDTCQGDSGGPMFRKDNDEWVQVGIVSWGGCARKGKYGVYTEVSTFASAIASAAR 227
41 -81.8001fxy_A mol:protein length:228 COAGULATION FACTOR XA-TRYPSIN CHIMERA  ali model follow..  22  1.............................................................................................IVGGYNCKDGEVPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPASLPTAPPAT-----GTKCLISGWGNTGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGGGKDSCQGDSGGPVVCNGQ----LQGVVSWGGCAQKNKPGVYTKVYNYVKWIKNTIA 225
42 -81.6001rjx_B mol:protein length:247 Plasminogen  ali model follow..  21  14.........................................................................................CPGAVVGGCVAYPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKPSSYKVILGAHQEEPHVQEIEVSRLFLEPTR------KDIALLKLSSPAVITDKVIPACLPS---PNYVVADRTECFITGWGEQGTFGAGLLMEAQLPVIENKVCNRYLNGRVQSTELCAGGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGGCARPNKPGVYVRVSRFVTWIEGVMR 245
43 -80.7005brr_E mol:protein length:252 Tissue-type plasminogen activator  ali model follow..  23  1.............................................................................................IKGGLFADIASHPWQAAIFAKHERFLCGGILISSCWILSAAHCFQEPHHLTVILGRTYPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDAQESSVVRTVALPP---ADLQLPDWTECELSGYGKHEALYSERLKEAHVRLYPSSRCTSLLQRTVTDNMLCAGNLHDACQGDAGGPLVCLNDGRMTLVGIISWGGCGQKDVPGVYTKVTNYLDWIRDNMR 251
44 -80.5001fiz_A mol:protein length:263 BETA-ACROSIN HEAVY CHAIN  ali model follow..  17  1.............................................................................................VVGGMSAEPGAWPWMVSLQNNRRYHTCGGILLNSHWVLTAAHCFKNKKKWRLIFGANEVKPPLQERFVEEIIIHEKYVSGLEINDIALIKITPPVPCGPFIGPGCLPQF--KAGPPRAPQTCWVTGWGEKGPRTSPTLQEARVALIDLELCNSTYNGRIRSTNVCAGGKIDTCQGDSGGPLMCRDENTFVVVGITSWGGCARAKRPGVYTSTWPYLNWIASKIG 249
45 -80.5001bda_A mol:protein length:265 SINGLE CHAIN TISSUE TYPE PLASMINOGEN ACTIVATO  ali model follow..  23  1................................................................................TCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHERFLCGGILISSCWILSAAHCFQEPHHLTVILGRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDAQESSVVRTVCLPP---ADLQLPDWTECELSGYGKHSPFYSERLKEAHVRLYPSSRCTSLLNRTVTDNMLCAGNLHDACQGDSGGPLVCLNDGRMTLVGIISWGGCGQKDVPGVYTKVTNYLDWIRDNMR 264
46 -80.2001a5i_A mol:protein length:265 PLASMINOGEN ACTIVATOR  ali model follow..  23  1................................................................................TCGLRKYKEPQLHSTGGLFTDITSHPWQAAIFAQNERFLCGGILISSCWVLTAAHCFQEPDQLKVVLGRVKPGEEEQTFKVKKYIVHKEFDDDTYNNDIALLQLKSDAQESDSVRAICLPE---ANLQLPDWTECELSGYGKHKSSYSEQLKEGHVRLYPSSRCAPLFNKTVTNNMLCAGNVHDACQGDSGGPLVCMNDNHMTLLGIISWGGCGEKDVPGVYTKVTNYLGWIRDNMH 264
47 -79.9001acb_E mol:protein length:245 ALPHA-CHYMOTRYPSIN  ali model follow..  21  14...........................................................................................SRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVT-TSDVVVAGEFDQSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPS---ASDDFAAGTTCVTTGWGLTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGSGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSTCSTSTPGVYARVTALVNWVQQTLA 243
48 -79.8004qt8_C mol:protein length:253 Hepatocyte growth factor-like protein  ali model follow..  18  1..........................................................................FEKCGKRVDRLDQRRSKLRVVGGH---PGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSLTGYEVWLGTLFQNPSLQRVPVAKMVCGPSG------SQLVLLKLERSVTLNQRVALICLPP---EWYVVPPGTKCEIAGWGETKGGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEAPVGACEGDYGGPLACFTHNSWVLEGIIIPNVCARSRWPAVFTRVSVFVDWIHKVMR 245
49 -79.8002wub_A mol:protein length:257 HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN  ali model follow..  18  1.............................................................................................IIGGSSSLPGSHPWLAAIYI--GDSFCAGSLVHTCWVVSAAHCFSHRDSVSVVLGQHFTTDVTQTFGIEKYIPYTLYSVNPSDHDLVLIRLKKKATRSQFVQPICLPE---PGSTFPAGHKCQIAGWGHLDENYSSSLREALVPLVADHKCSSVYGADISPNMLCAGCKSDACQGDSGGPLACEKNGVAYLYGIISWGGCGRLHKPGVYTRVANYVDWINDRIR 239
50 -79.8004xde_A mol:protein length:257 Coagulation factor XII  ali model follow..  19  1...........................................................................................RSVVGGLVALRGAHPYIAALYW--GHSFCAGSLIAPCWVLTAAHCLQDPEDLTVVLGQERSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDALLSPYVQPVSLPS---GAARPSETTLCQVAGWGHQAEEYASFLQEAQVPFLSLERCSAVHGSSILPGMLCAGGGTDACQGDSGGPLVCEDQAALTLQGIISWGGCGDRNKPGVYTDVAYYLAWIREHTV 244
51 -79.7001q3x_A mol:protein length:328 Mannan-binding lectin serine protease 2  ali model follow..  18  1.....ASMTIVDCGPPDDLPSGRVEY-----------ITGPGVTTYKAVIQYSCEEYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGGRIYGGQKAKPGDFPWQVLIL---GGTTAAGALLYDNWVLTAAHAVHDASALDIRMGTLKRLSHYTQAWSEAVFIHEGYTHDAFDNDIALIKLNNKVVINSNITPICLPRKE-AESFMRTDDIGTASGWGLQRGFLARNLMYVDIPIVDHQKCTAAYRGSVTANMLCAGGGKDSCRGDSGGALVFSETERWFVGGIVSWGNCGEAGQYGVYTKVINYIPWIENIIS 326
52 -79.6001m9u_A mol:protein length:241 Earthworm Fibrinolytic Enzyme  ali model follow..  18  1.............................................................................................VIGGTNASPGEFPWQLSQQRQSGSHSCGASLLSSTSALSASHCVDGPNNIRVIAGLWQQSDTSQTANVDSYTMHENYGAGTYSNDIAILHLATSISLGGNIQAAVLPA---NNNNDYAGTTCVISGWGRGTNNLPDILQKSSIPVITTAQCTAAMGANIWDNHICVQGNTGACNGDSGGPLNCP-DGGTRVVGVTSWVGACLPDYPSVYTRVSAYLGWIGDNS. 241
53 -79.5001ym0_A mol:protein length:238 fibrinotic enzyme component B  ali model follow..  18  1.............................................................................................IVGGIEARPYEFPWQVSVRKSSDSHFCGGSIINDRWVVCAAHCMQAPALVSLVVGEHDASTVRQTHDVDSIFVNENYDPATLENDVSVIKTAVAITFDINVGPICAPDPAND----YVYRKSQCSGWGTIGVCCPAVLRYVTLNITTNAFCDAVYSDTIYDDMICATTDRDSCQGDSGGPLSVKDSGIFSLVGIVSWGIGCASGYPGVYSRVGFHAGWITDTIT 236
54 -79.1001fiw_A mol:protein length:290 BETA-ACROSIN HEAVY CHAIN  ali model follow..  16  1.............................................................................................IIGGQDAAHGAWPWMVSLQNNRRYHVCGGSLLNSQWLLTAAHCFRIKKKWRLIFGAKEVEPPLQERYVEKIIIHEKYSASSEANDIALMKITPPVTCGHFIGPGCLPQF--RAGPPRVPQTCWVAGWGENARRTSPMLQEARVDLIDLGLCNSTYNGRIRSTNVCAGGKIDTCQGDSGGPLMCKDENSYVVVGITSWGGCARAKRPGVYTSTWSYLNWIASKIG 249
55 -78.8001fn8_A mol:protein length:224 TRYPSIN  ali model follow..  17  1.............................................................................................IVGGTSASAGDFPFIVSIS-RNGGPWCGGSLLNANTVLTAAHCVSAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYS--GNNNDLAILKLSTSIPSGGNIGYARLAA---SGSDPVAGSSATVAGWGATGSSTPVNLLKVTVPIVSRATCRAQYGSAITNQMFCAGGGKDSCQGDSGGPIVDS---SNTLIGAVSWGGCARPNYSGVYASVGALRSFIDTYA. 224
56 -78.6004k3j_A mol:protein length:233 Hepatocyte growth factor  ali model follow..  17  1.............................................................................................VVNGIPT-RTNIGWMVSLRY-RNKHICGGSLIKESWVLTARQCFPSRKDYEAWLGIHDVHGRGDE-KCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPN---YGSTIPEKTSCSVYGWGYTGLNYDGLLRVAHLYIMGNEKCSQHHKVTLNESEICAGIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGGCAIPNRPGIFVRVAYYAKWIHKII. 226
57 -78.6003beu_A mol:protein length:224 Trypsin  ali model follow..  17  1.............................................................................................VVGGTRAAQGEFPFMVRLS-----MGCGGALYAQDIVLTAAHCVSNNTSITATGGVVDLQSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQ-----PTLKI----ATTTAYNQGTFTVAGWGREGGSQQRYLLKANVPFVSDAACRSSSSFLVANEMICAGKQEDTCQGDSGGPMFRKDNDEWVQVGIVSWGGCARKGKYGVYTEVSTFASAIASAAR 222
58 -78.4003i77_A mol:protein length:230 Trypsin  ali model follow..  19  1.............................................................................................VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSNNTSITATGGVVDLQSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQ-----PTLKI----ATTTAYNQGTFTVAGWGREGGSQQRYLLKANVPFVSDAACRSSSSFLVANEMICAGGGVDTCQGDSGGPMFRKDNDEWIQVGIVSWGGCARPGYPGVYTEVSTFASAIASAAR 228
59 -78.1001si5_H mol:protein length:240 hepatocyte growth factor  ali model follow..  17  1.............................................................................................VVNGIPT-RTNIGWMVSLRY-RNKHICGGSLIKESWVLTARQCFPSRKDYEAWLGIHDVHGRGDE-KCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPN---YGSTIPEKTSCSVYGWGYTGLNYDGLLRVAHLYIMGNEKCSQHHKVTLNESEICAGIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGGCAIPNRPGIFVRVAYYAKWIHKIIL 227
60 -77.7004wjg_C mol:protein length:315 Haptoglobin  ali model follow..  20  1...........................CPKPPEIAHGYVEHSVRYQCKNYY----KLRTEGDGVYTLN-NEKQWINKAVGDKLPECEAVCGKRILGGHLDAKGSFPWQAKMV-SHHNLTTGATLINEQWLLTTAKNLNHSENATAKDIAPTLTGKKQLVEIEKVVLHPNYS----QVDIGLIKLKQKVSVNERVMPICLPSKDYAE----VGRVGYVSGWGRANFKFTDHLKYVMLPVADQDQCIRHYEGSLNEHTFCAGYQEDTCYGDAGSAFAVHEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIA 313
61 -77.5001eq9_A mol:protein length:222 CHYMOTRYPSIN  ali model follow..  20  1.............................................................................................IVGGKDAPVGKYPYQVSLRL-SGSHRCGASILDNNNVLTAAHCVDNLNRLKVHVGTNYLSESGDVYDVEDAVVNKNYDDFLLRNDVALVHLTNPIKFNDLVQPIKLSTNDED----LESNPCTLTGWGRLGGNTPNALQEIELIVHPQKQCERDQW-RVIDSHICTLRGEGACHGDSGGPLVAN----GAQIGIVSFGSPCALGEPDVYTRVSSFVSWINANLK 221
62 -77.5004m7g_A mol:protein length:227 Trypsin-like protease  ali model follow..  22  1.............................................................................................IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVQPADINVVSGRTVMSSNETVSKVTNVWVHPEYQDAAKGFDVSVLTLEAPVKEA----PIELAKAD--DAGYAPDTAATILGWGSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPDAMVCAGGGVDTCQGDSGGPMVVN----NKLIGVTSWGGCARPGKPGVYARVGAYYDVLMEQIN 223
63 -77.3004xsk_U mol:protein length:246 Urokinase-type plasminogen activator  ali model follow..  18  1.............................................................................................IIGGEFTTIENQPWFAAIYRGSVTYVCGGSLISPCWVISATHCFIDKEDYIVYLGRSRNTQGEMKFEVENLILHKDYSADTHHNDIALLKIRSKAQPSRTIQTIALPS---MYNDPQFGTSCEITGFGKEQSTYPEQLKMTVVKLISHRECQQYYGSEVTTKMLCAAWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGGCALKDKPGVYTRVSHFLPWIRSHTK 246
64 -77.2004h4f_A mol:protein length:249 Chymotrypsin-C  ali model follow..  24  1.............................................................................................VVGGEDARPHSWPWQISLQNDTWRHTCGGTLIASNFVLTAAHCISNTRTYRVAVGKNNLEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLPE---KDSLLPKDYPCYVTGWGRTNGPIADKLQQGLQPVVDHATCSRIWGFRVKKTMVCAGGVISACNGDSGGPLNCQENGSWEVFGIVSFGGCNTRKKPVVYTRVSAYIDWINEKMQ 238
65 -76.5004igd_A mol:protein length:406 Mannan-binding lectin serine protease 1  ali model follow..  18  43.LKDNVEMDTIECLKDGTWSNKIPTKIVDCRAPGELEHGLITFSTRNNLTTYKSEYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGAQIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDFKIILGKHWRDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQE-----GAMVIVSGWGKQLQRFPETLMEIEIPIVDHSTCQKAYKKKVTRDMICAGGGKDACAGDSGGPMVTRERGQWYLVGTVSWGDCGKKDRYGVYSYIHHNKDWIQRVTG 403
66 -76.4004f4o_C mol:protein length:347 Haptoglobin  ali model follow..  16  11.......LLCGQLFAAETGNEATDATDDSCPKPPEIPK---YVEHMVRYHCQTYYKLRTAGDGVYTLD-SNKQWTNKVTGEKLPECEAVCGKRIMGGSLDAKGSFPWQAKMI-SHHNLTSGATLINEQWLLTTAKNLGHKNDTKAKDIAPTLRGKKQEVEIEKVIFHPDN----STVDIGLIKLKQKVPVNERVMPICLPSKDY----VNVGLVGYVSGWGRANLNFTEHLKYVMLPVADQEKCVQYYEGSLNEHTFCAGYQEDTCYGDAGSAFAVKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIA 345
67 -76.4001elv_A mol:protein length:333 COMPLEMENT C1S COMPONENT  ali model follow..  19  3......DCIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMEN----------------GGGGEYHCA-GNGSWVNEVLGPELPKCVPVCGQRIIGGSDADIKNFPWQVFF----DNPWAGGALINEYWVLTAAHVVEGNREPTMYVGSTSVQTKSKMLTPEHVFIHPGWKRTNFDNDIALVRLKDPVKMGPTVSPICLPGTS-SDYNLMDGDLGLISGWGREKRDRAVRLKAARLPVAPLRKCKEVKVEKFTPNMICAGKGMDSCKGDSGGAFAVQDKTKFYAAGLVSWGQCG---TYGLYTRVKNYVDWIMKTMQ 325
68 -76.3004j1y_A mol:protein length:397 Complement C1s subcomponent  ali model follow..  19  49TCQSNGKWSNSKLK----CQP----VDCGIPESIENGKVEDPESTLGSVIRYTCEEYYMENGGGGEYHCGNGSWVNEVLGPELPKCVPVCGVRAIGGSDADIKNFPWQVFF----DNPWAGGALINEYWVLTAAHVVEGNREPTMYVGSTSVQAKSKMLTPEHVFIHPGWKRTNFDNDIALVRLKDPVKMGPTVSPICLPGTS-SDYNLMDGDLGLISGWGRTERDRAVRLKAARLPVAPLRKCKEVKVEKFTPNMICAGKGMDSCKGDSGGAFAVQDKTKFYAAGLVSWGQCG---TYGLYTRVKNYVDWIMKTMQ 389
69 -76.2002nwn_A mol:protein length:253 Plasminogen activator, urokinase  ali model follow..  18  1.............................................................................................IIGGEFTTIENQPWFAAIYRRHVTYVCGGSLISPCWVISATHCFIDKEDYIVYLGRSRNTQGEMKFEVENLILHKDYSADTHHNDIALLKIRSKAQPSRTIQTIALPS---MYNDPQFGTSCEITGFGKEQSTYPEQLKMTVVKLISHRECQQYYGSEVTTKMLCAAWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGGCALKDKPGVYTRVSHFLPWIRSHTK 246
70 -76.2004kkd_A mol:protein length:433 Mannan-binding lectin serine protease 1  ali model follow..  18  55.LKDGTWSNKIPTCKIVDCRAP--GELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQRIIGGRNAEPGLFPWQALIVVPNDKWFGSGALLSASWILTAAHVLRSKEHVTVYLGLHDVRDGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLE--PEGPAPHMLGLVAGWGISNRTLSDVLQYVKLPVVPHAECKTSYNYSVTENMFCAGGGKDTCLGDSGEAFVIDLSQRWVVQGLVSWGECGSKQVYGVYTKVSNYVDWVWEQMG 421
71 -76.1001utj_A mol:protein length:242 TRYPSIN I  ali model follow..  20  12....................................................................................AAFATEDDKIVGGYECKPYSQPHQVSLN--SGYHFCGGSLVNENWVVSAAHCYK--SRVEVRLGEHNIEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAP-----AGTMCTVSGWGMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGGGKDSCQGDSGGPVVCN----GELQGVVSWGGCAEPGNPGVYAKVCIFNDWLTSTMA 240
72 -76.1001ybw_A mol:protein length:283 Hepatocyte growth factor activator precursor  ali model follow..  18  6...............................................................DLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYI--GDSFCAGSLVHTCWVVSAAHCFSHRDSVSVVLGFNRTTDVTQTFGIEKYIPYTLYSVNPSDHDLVLIRLKKKATRSQFVQPICLPE---PGSTFPAGHKCQIAGWGHLDENYSSSLREALVPLVADHKCSSVYGADISPNMLCAGCKSDACQGDSGGPLACEKNGVAYLYGIISWGGCGRLHKPGVYTRVANYVDWINDRIR 274
73 -76.0001b0e_A mol:protein length:240 PROTEIN (ELASTASE)  ali model follow..  19  1.............................................................................................VVGGTEAQRNSWPSQISLQYRSGSHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNGTEQYVGVQKIVVHPYWNTDDAGYDIALLRLAQSVTLNSYVQLGVLPR---AGTILANNSPCYITGWGLTNGQLAQTLQQAYLPTVDYAICSSSWGSTVKNSMVCAGGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVGCNVTRKPTVFTRVSAYISWINNVIA 238
74 -76.0001elt_A mol:protein length:236 ELASTASE  ali model follow..  23  1.............................................................................................VVGGRVAQPNSWPWQISLQYKSGSHTCGGSLIRQGWVMTAAHCVDSARTWRVVLGEHNLEGKEQIMTVNSVFIHSGWNSDDGGYDIALLRLNTQASLNSAVQLAALPP---SNQILPNNNPCYITGWGKTGGPLSDSLKQAWLPSVDHATCSSSWGSTVKTTMVCAGGANSGCNGDSGGPLNCQVNGSYYVHGVTSFVGCNASKKPTVFTRVSAYISWMNGIM. 236
75 -75.5002eek_A mol:protein length:220 Trypsin-1  ali model follow..  20  1.............................................................................................IVGGYECTKHSQAHQVSLN--SGYHFCGGSLVSKDWVVSAAHCYK--SVLRVRLGEHHIEGTEQYISSSSVIRHPNYSSYNINNDIMLIKLTKPATLNQYVHAVALPTECAA-----DATMCTVSGWGNTMSADGDKLQCLSLPILSHADCANSYPGMITQSMFCAGGGKDSCQGDSGGPVVCN----GVLQGVVSWGGCAERDHPGVYAKVCVLSGWVRDTMA 220

FFAS is supported by the NIH grant R01-GM087218-01
1 1 5 0 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.