current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3fuq_A mol:protein length:417 BoNT/F (Neurotoxin type F), from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst LYKKIKDNSILDMRYENNKFIDISGYGSNISINGDVYIYSTNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNQKLVFNYTQMISISDYINKWIFVTITNNRLGNSRIYINGNLIDEKSISNLGDIHVSDNILFKIVGCNDTRYVGIRYFKVFDTELGKTEIETLYSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSNTRLYTGVEVIIRKNGSTDISNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKLIRTSNSNNSLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTSSNGCFWSFISKEHGWQENLast
1 -117.0003fuq_A mol:protein length:417 BoNT/F (Neurotoxin type F)  ali model  100  1LYKKIKDNSILDMRYENNKFIDISGYGSNISINGDVYIYSTNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNQKLVFNYTQMISISDYINKWIFVTITNNRLGNSRIYINGNLIDEKSISNLGDIHVSDNILFKIVGCNDTRYVGIRYFKVFDTELGKTEIETLYSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSNTRLYTGVEVIIRKNGSTDISNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKLIRTSNSNNSLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTSSNGCFWSFISKEHGWQEN 417
2 -92.3004jra_A mol:protein length:443 Botulinum neurotoxin type A  ali model follow..  49  12..KNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPKNQIQLFNLESSKIEVILKNAIVYN--SMYENFSTSFWIRIPKYFNSISLNNEYTIIN-CMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYAS---GNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKQGITNKCKMNLQDNNGNDIGFIGFHQAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGER 435
3 -88.8002vu9_A mol:protein length:444 BOTULINUM NEUROTOXIN A HEAVY CHAIN  ali model follow..  49  12..GSHMDTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIIN-CMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYAS---GNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKQGITNKCKMNLQDNNGNDIGFIGFHQFKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGER 435
4 -87.7004kbb_A mol:protein length:459 Botulinum neurotoxin type B  ali model follow..  34  20..SEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDK--NQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIYIHNEYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNL-NNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQ-SINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISDSDEFYNTIQIKEQPTYSCQLLFKKDEESTDEIFEEYKDYFCISKWYLKEVKRKNLKLGCNWQFIPKDEGWTE. 453
5 -85.3001d0h_A mol:protein length:469 PROTEIN (TETANUS TOXIN HC)  ali model follow..  27  24...ILKKSTILNLDINNDIISDISGFNSSVITYPDAQLVPGINGKAIHLVNNESEVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGSSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYVSYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMDLKTYSVQLKLYDDKNASLGLVGTHNDILIASNWYFNHLKDK--ILGCDWYFVPTDEGWTND 459
6 -85.0003obr_A mol:protein length:434 Botulinum neurotoxin type D  ali model follow..  26  7..ASINDSKILSLQNKKNALVDTSGYNAEVRVGDNVQLNTIY-TNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLTNSHNE---YTIINSIEQNSGWKLCIRNGNIEWILQDVNRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYINGELKQSQKIEDLDEVKLDKTIVFGIDENDENQMLWIRDFNIFSKELSNEDINIVYEGQILRNVIKDYWGNPLKFDTEYYIINDNYIDRYIAPESNVLVLV---------QYPDRSKLYTGNPITIKSVSD---KNPYSRILNGDNIILHMLYNSRKYMIIRDTDTCSQNCVYALKLQSNLGNYGIGIFSIKNIVSYCSQIFSSFRENTMLLADIYKPWRFSFKNAYTNYETKLLSTSSFWKFISRDPGWVEP 422
7 -84.8003pme_A mol:protein length:420 Type C neurotoxin  ali model follow..  26  1...SINDSKILSLQNKKNALVDTSGYNAEVRLEGDV-QVNTIYTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLTNSHNE---YTIINSIKQNSGWKLCIRNGNIEWILQDINRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMKLYINGELKQSERIEDLDEVKLDKTIVFGIDENDENQMLWIRDFNIFSKELSNEDINIVYEGQILRNVIKDYWGNPLKFDTEYYMINYNYIDRYIAPKNNILVLV---------QYSDISKLYTKNPITIKSAAN---KNPYSRILNGDDIMFHMLYDSREYMIIRDTDTIYATQGGQCSKNCNYGIGIFSIKNIVSQNKYCSQIFSSFMKNTMLLADIYKPWRFSFENAYTPVAVTLLSTSSFWKFISRDPGWVE. 414
8 -84.4002vxr_A mol:protein length:482 BOTULINUM NEUROTOXIN TYPE G  ali model follow..  33  40..SNISSNAILSLSYRGGRLIDSSGYGATMNVGSDVIFNDIGNGQFKLNNSENSNITAHQSKFVVYDSMFDNFSINFWVRTPKYNNNDIQTQNEYTIISCIKNDSGWKVSIKGNRIIWTLIDVNAKSKSIFFEYSIKDNISDYINKWFSITITNDRLGNANIYINGSLKKSEKILNLDRINSSNDIDFKLINCDTTKFVWIKDFNIFGRELNATEVSSLYWIQSSTNTLKDFWGNPLRYDTQYYLFNQGMQNIYIKYFSKASMGETAPRTNFNNAAINYQNLYLGLRFIIKKASNSRNINNDNIVREGDYIYLNIDNISDESYRVYVLVNSKEIQTQLFLAPINDDPTFYDVLQIKKYYEKTTYNLCEKDTKTFGLFGIGKNYFCISQWYLRRISENKLRLGCNWQFIPVDEGWTEL 475
9 -79.0001fv2_A mol:protein length:472 TETANUS TOXIN HEAVY CHAIN  ali model follow..  26  30..VILKKSTILNLDINNDIISDISGFNSSVITYPDAQLVPGINGKAIHLVNNESSVIVHKAMDIEYNDMFNNFTVSFWLRVPKVSASHLEQYGSSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLPDKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNNQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDVQLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYVSYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLY-LRDLKTYSVQLKLYDDKNASLGLVGTNRDILIASNWYFNHLKD--KILGCDWYFVPTDEGWTND 466
10 -78.8003r4s_A mol:protein length:443 Botulinum neurotoxin type C1  ali model follow..  28  6..ANINDSKILSLQNRKNTLVDTSGYNAEVSEEGDVQLNPIFPFDFKLGSSGEDRGKVTQNENIVYNSMYESFSISFWIRINKWVSNLPGYT----IIDSVKNNSGWSIGIISNFLVFTLKQNEDSEQSINFS-YDISNNAPGYNKWFFVTVTNNMMGNMKIYINGKLIDTIKVKELTGINFSKTITFEINSDSDNINMWIRDFYIFAKELDGKDINILFNSLQYTNVVKDYWGNDLRYNKEYYMVNIDYLNRYMYANSRQIVFNT---------RRNNNDFNEGYKIIIK---RIRGNTNDTRVRGGDILYFDMTINNKAYNLFMKNHSTEDIYAIGLREQTKDINDNIIFQIQPMNNTY-KSNFNGENISGICSIGTYRFRL-GGDWYRHNYASLLESTSTHWGFVPVSEPGSEK 443
11 -75.5004isq_A mol:protein length:431 Neurotoxin  ali model follow..  26  1MYFSINDSKILSLQNKKNTLMDTSGYNAEVRVEGNVQLNPIFPFDFKLGSSGDDKVIVTQNENIVYNAMYESFSISFWIRINKWVSNLPGYT----IIDSVKNNSGWSIGIISNFLVFTLKQNENSEQDINFSYDISKN-AAGYNKWFFVTITTNMMGNMMIYINGKLIDTIKVKELTGINFSKTITFQMNSDSDNINMWIRDFYIFAKELDDKDINILFNSLQYTNVVKDYWGNDLRYDKEYYMINVNYMNRYMSKKGNGIVFNTRKN---------NNDFNEGYKIIIK---RIRGNTNDTRVRGENVLYFNTTIDNKQYSLGMYKPSRNLGTDLVPLMDEIRKYGSFIIQPCNTFDYYASQLFLSSNATTNRLGILSIGSYFNHEYLIPVIASLLESTSTHWVFVPAS...... 425
12 -71.6003azv_A mol:protein length:443 D/C mosaic neurotoxin  ali model follow..  25  10YFNSINDSKILSLQNKKNTLMDTSGYNAEVRVEGNVQLNPIFPFDFKLGSSGDDKVIVTQNENIVYNAMYESFSISFWIRINKWVSNLPGYT----IIDSVKNNSGWSIGIISNFLVFTLKQNENSEQDINFSYD-ISKNAAGYNKWFFVTITTNMMGNMMIYINGKLIDTIKVKELTGINFSKTITFQMNSDSDNINMWIRDFYIFAKELDDKDINILFNSLQYTNVVKDYWGNDLRYDKEYYMINVNYMNRYMSKKGNGIVFNT---------RKNNNDFNEGYKIIIKRIRG---NTNDTRVRGENVLYFNTTIDNKQYSLGMYKPSRNLGTDLVPPMDEIRKYGSFIIQPCNTFDYYASQLFLSSNATTNRLFKLGDDYWFNHEYLIEHYASLLESTSTHWVFVPASE---E. 437
13 -57.2003ffz_A mol:protein length:1252 Botulinum neurotoxin type E  ali model follow..  59  843FFKRIKSSSVLNMRYKNDKYVDTSGYDSNININGDVYKYPTNKNQFGIYNDKLSEVNISQNDYIIYDNKYKNFSISFWVRIPNYDNKVNVNNEYTIINCMRDNNSGWKVSLNHNEIIWTLQDNAGINQKLAFNYGNANGISDYINKWIFVTITNDRLGDSKLYINGNLIDQKSILNLGNIHVSDNILFKIVNCSYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNILKDFWGNYLLYDKEYYLLNVLKPNNFIDRRKDSTLSINNIRSTILLANRLYSGIKVKIQ------RVNNSSTNDNLVRKNDQVYINFVASKTHLFPLYADTATTNKE--KTIKISSSGNRFNQVVVMNSVGNNCTMNFKNNNGNNIGLLGFKADTVVASTWYYTHMRDHTNSNGCFWNFISEEHGWQEK 1252
14 -56.0004qvs_A mol:protein length:227 S-layer domain-containing protein  ali model follow..  16  2.....NAETGAWYMFDTNEFKDYKGNHGNAVLYSANGVVPGLNGNSVSLDGVDDYVALPDG----IAGTFYNFTIAFWVRLDTIGEQP------IFDFFDSGSNNKYMRLTAESDGKIKFAMTQSGYYG---EKTITSGSALTEGVWKHVAVTLSG-DTGTLYINGENVGENNTLSLRPLGETSKGYIGKSHQTDYLHGMIDDFRIFDRALSADEIKTLASVATRVN.............................................................................................................................................................................................. 227
15 -53.2004zkt_A mol:protein length:1252 Bontoxilysin A  ali model follow..  59  843FFKRIKSSSVLNMRYKNDKYVDTSGYDSNININGDVYKYPTNKNQFGIYNDKLSEVNISQNDYIIYDNKYKNFSISFWVRIPNYDNKVNVNNEYTIINCMRDNNSGWKVSLNHNEIIWTLQDNAGINQKLAFNYGNANGISDYINKWIFVTITNDRLGDSKLYINGNLIDQKSILNLGNIHVSDNILFKIVNCSYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNILKDFWGNYLLYDKEYYLLNVLKPNNFIDRRKDSTLSINNIRSTILLANRLYSGIKVKIQ------RVNNSSTNDNLVRKNDQVYINFVASKTHLFPLYADTATTNKEKTI--KISSSGNRFNQVVVMNSVGNNCTMNFKNNNGNNIGLLGFKADTVVASTWYYTHMRDHTNSNGCFWNFISEEHGWQEK 1252
16 -52.3003v0c_A mol:protein length:1312 BoNT/A  ali model follow..  50  871..KNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIIN-CMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGMYLKGPRGSVMTTNIYLNSSLYRGAKFIIKKYAS---GNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMDQGITNKCKMNLQDNNGNDIGFIGFNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGER 1294
17 -43.9001epw_A mol:protein length:1290 BOTULINUM NEUROTOXIN TYPE B  ali model follow..  32  858..EILNNIILNLRYKDNN-LIDLSGYGAKVEVYDGVELNDKNQFKL--TSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIYIHNEYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNL-NNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQ-SINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISDSDEFYNTIQIKEQPTYSCQLLFKKDEESTDEIGLIGKDYFCISKWYLKEVKRKNLKLGCNWQFIPKDEGWTE. 1290
18 -43.0002v73_A mol:protein length:191 PUTATIVE EXO-ALPHA-SIALIDASE  ali model follow..  1.............................GMASIKGEVDEIANYGNLKITKEEERVNIT--GDLEKFSSLEEGTIVTRFNMNDTSIQSLIG-----LSDGNKANNYFSLYVSGGKVGYELRRQEGNGDF----NVHHSADVTFNRGINTLALKIEKGIGAKIFLNGSLVKTVSDPNILNAINLNSGFIGKTDRANLFRGNIDFMNIYDKPVSDNYLLRKTGETK................................................................................................................................................................................................. 191
19 -41.9004c1w_A mol:protein length:188 NEURAMINIDASE  ali model follow..  13  1.................................GAMVIEK---EDVETNASNGQRVDL--SSELDKLKKLENATVHMEFKPDAKAPAFYNL---FSVSSATKKDEYFTMAVYNNTATLEGRGSDGKQFY---NNYNDAPLKVKPGQWNSVTFTVEKKGRVRLYVNGVLSRTSLRSGIKDMPDVTHVQIGATKRANGSNLQIRNLTVYNRALTPEEVQKR...................................................................................................................................................................................................... 187
20 -39.2003v0a_B mol:protein length:1196 NTNH  ali model follow..  20  833..EETWPYELVLYAFKNNVIGDASGKNTSIEYSKDIGLVYGINSDALYLNGSNQSISFSNDFFEN--GLTNSFSIYFWLRNLGKDTI------KSKLIGSKEDNCGWEIYFQDTGLVFNMIDSNGNE-------KNIYLSDVSNNSWHYITISVDRLKELLIFIDDNLVANESIKEILNIYSSNIISLL----SENNPSYIEGLTILNKPTTSQEVLSNYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQ------------NNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDISEDN--------RLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMK--------DENHNWMICNNDMSKYLYLWSFKP........ 1196
21 -36.0004zkt_B mol:protein length:1163 Botulinum neurotoxin type E, nontoxic-nonhema  ali model follow..  20  796..EQTSPYELSLYAFQNNVIGDTSGKNTLVEYPKDIGLVYGINNNAIHLTGANQNIKFTNDYFEN--GLTNNFSIYFWLRNLKQNTI------KSKLIGSKEDNCGWEIYFENDGLVFNIIDSNGNEKN-------IYLSNISNNSWHYIVISINRLKDLLIFIDNILVANEDIKEILNIYSSDIISLL----SDNNNVYIEGLSVLNKTINSNEILTDYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQ------------NNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNN-------RIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNVYLSIKN------QDYNWVICDLNHDIPKKSYLW............ 1158
22 -33.3003vuo_A mol:protein length:1196 NTNHA  ali model follow..  20  830..EMLSPYQLLLFATRSNIIEDISGKNTLIQYTESVELVYGVNGESLYLKSPNETVEFSNNFFTN--GLTNNFTICFWLRFTGKDDDKTRL-------GNKVNNCGWEIYFEDNGLVFEIIDSNGNQ-------ESVYLSNVINNNWYYISISVDRLKDLLIFINDKNVANVSIEQILNIYSTNVISLV----NKNNSIYVEELSVLDKPVASEEVIRNYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVND------------NNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISPENN-------RIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLR--------DGDYNWMICNDNNKVPKGAHLWILKS...... 1196
23 -26.7004dqa_A mol:protein length:355 uncharacterized protein  ali model follow..  139............................................ITKAGNFSNHYISVKFPVGTFF----SSFTYEALINVDYFLDNNTI-----MGTEGVMILRIGDAGGGITPKDYLEVAG---------GQNYRVTKPLLTNRWYHVALTYDQTGKTGIYVNGEKWAGSDWGIDGDPNSDMGFYIGRIWGERPFHGKMSEVRVWSVARTENQLKQ....................................................................................................................................................................................................... 300
24 -24.0004pbp_A mol:protein length:210 C-reactive protein  ali model follow..  1...................................MEFFKNLSGKVLQFATDNSYVKLYPEKPLSL----SAFTLCMRVATELPLDREVILFAYYT----PDVDELNVWRERDGRVSLYIQSS---------KDAAFFRLPPLSTLQTHLCVAWESTGLTAFWMDGRRSLHQVYRKGYSIRSGGTVVLGQDDVDQSFVGEIANLQMWDYVLSSAQIKAVYYNQD................................................................................................................................................................................................. 183
25 -23.0001b09_A mol:protein length:206 PROTEIN (C-REACTIVE PROTEIN)  ali model follow..  10  14.................................................ESDTSYVSLKAPLTKPL----KAFTVCLHFYTELSSTRGYSIFSYATKRQDNE--------------ILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESSGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFT............................................................................................................................................................................ 200
26 -22.7003zyp_A mol:protein length:218 CIP1  ali model follow..  10  1...EISDD------FESGWDQTKPISAPDCNQGGTVSLDTTSGSNSMKVVGGPN----GHIFFGTTQVPTGDVYVRAWIRLQTALGSNHVT--FIIMPDTAQGGKHLRIGGQSQVLDYNRESDDATLPDLS-PNGIASTVTLPTGAFQCFEYHLGTDGTIETWLNGSLIPGMTVGPGVDNPNDAGWTRAEAYSGDVNTVWFDDISIASTRVG............................................................................................................................................................................................................. 216
27 -21.8001gyk_A mol:protein length:204 SERUM AMYLOID P-COMPONENT  ali model follow..  11  5..........................................SGKVFVFESVTDHVNLITPLEKPL----QNFTLCFRAYSDLSRAYSLF---------------SYNTQGRDNELLV-YKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVII............................................................................................................................................................................ 198
28 -20.6003flp_A mol:protein length:217 SAP-like pentraxin  ali model follow..  1......................................AVDIRDVKISFTQNPKFPHLRFMQTLP---AVRQLTVCQRIKPFSCATSNQDNQFITSMYVKSDGTLNLGLQVNASSNKY-----------------ISCPIEIELGQWYHVCHVWSGDGRMAVYANGSPCGTENVGKGHQISAGGTVVIGQEEEQESWSGELSDLQVWDEALTTHQVSTVASCNG................................................................................................................................................................................................. 186
29 -17.9001za4_A mol:protein length:251 Thrombospondin 1  ali model follow..  10  12...............GDNSVFDIFELTGAARKGSGRRLVKGPSSPAFRIEDANLIPPVPDDDLVDAVRTEKGFLLLASLRQMKKTRGTLLA-----LERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVV----SVEEALLATGQWKSITLFVQED-RAQLYIDCEKMENAELDVTRDLASIARLRIAKGGVNDNFQGVLQNVRF----VFGTTPEDILRNK.................................................................................................................................................................................................. 216
30 -16.9003biw_E mol:protein length:243 Neurexin-1-beta  ali model follow..  42.................................SPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF--------STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGLTIFNSQATIIIGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDANIAI............................................................................................................................................................................................ 219
31 -16.8002r1d_A mol:protein length:226 Neurexin-1-beta  ali model follow..  10  38...........................................GTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF--------STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGLTIFNSQATIIIGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDAN............................................................................................................................................................................................... 202
32 -15.0003b3q_E mol:protein length:197 NRXN1 protein  ali model follow..  10  12...........................................GTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF--------STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGLTIFNSQATIIIGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDANIAI............................................................................................................................................................................................ 179
33 -14.9003bop_A mol:protein length:175 beta-Neurexin 2D4  ali model follow..  1...........................................ATTYIFGKGGALITYTWPPNDRPSTRMDRLAVGF--------STHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDD------ITIDEPNAIVSDGKYHVVRFTRSG-GNATLQVDSWPVNERYPAGLTIFNSQAAIKIGGRDQGRPFQGQVSGLYY-----NGLKVLALAAESDPNVRT............................................................................................................................................................................................ 168
34 -14.8004xun_A mol:protein length:181 Endo-1,4-beta-xylanase C  ali model follow..  11  11.....AGQALFKADFEDGNIGNWRARGTEKLEVVSGIGHNS--NRSLKTSSRSETYHGPLVEVLPYLQKGSTVHISFWAMYDEGPATQVINGSLEKEFNRDTANLEY---------------------------AMFASTTLNKGQWKKIEADITGISGLRMYAETPWKQSSEVTETDTIP------------------YVDDVQI--TATEAIAIEK....................................................................................................................................................................................................... 181
35 -14.5003vkf_C mol:protein length:181 Neurexin-1-beta  ali model follow..  10  2..........................................SGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF--------STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGLTIFNSQATIIIGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDANIAI............................................................................................................................................................................................ 170
36 -14.1003mw3_A mol:protein length:208 Neurexin-2-beta  ali model follow..  1........................................GPGSTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGF--------STHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDD------ITIDEPNAIVSDGKYHVVRFTRSG-GNATLQVDSWPVNERYPAGNFDARQRIPYRLGGRDQGRPFQGQVSGLYY-----NGLKVLALAAESDPNVRT............................................................................................................................................................................................ 201
37 -14.0002uur_A mol:protein length:245 COLLAGEN ALPHA-1(IX) CHAIN  ali model follow..  14  2.VKRRPRFPVNSNSNGGNELDDLPGFDDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKN--NIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLS----SLFDSQWHKIMIGVERS-SATLFVDCNRIESLPIKPRGPIDIDGFAVLGKDNPQVSVPFELQWMLIHDPLRPRRE.......................................................................................................................................................................................................... 227
38 -13.9003bod_A mol:protein length:178 Neurexin-1-alpha  ali model follow..  10  4...........................................GSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF--------STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLN............................................................................................................................................................................................................ 160
39 -13.7003mw4_A mol:protein length:178 Neurexin-2-beta  ali model follow..  1........................................GPGSATYIFGKSGGLILYTWPANDRPSTRSDRLAVGF--------STTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVD------ISIKEERTPVNDGKYHVVRFTRNG-ANATLQVDNWPVNEHYPTGLTIFNTQAQIAIGGKDKGRLFQGQLSGLYY-----DGLKVLNMAAENNPNIKI............................................................................................................................................................................................ 171
40 -13.7003mw2_A mol:protein length:207 Neurexin-1-alpha  ali model follow..  3...........................................GSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF--------STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGNNDARQRIPYRLGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDANIAI............................................................................................................................................................................................ 200
41 -13.5002h0b_A mol:protein length:184 Neurexin-1-alpha  ali model follow..  7.............................................IATFKG-SEYFCYDLSQN---PIQSSSDEITLSFKTLQRNG---------LMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALV----EPVNGKFNDNAWHDVKVTRNL-RQVTISVDGILTTTGYTQEDYTLGSDDFFYVGGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPK................................................................................................................................................................................................ 178
42 -13.5002r16_A mol:protein length:182 Neurexin-1-alpha  ali model follow..  1.......................................GSREATVLSYDG-SMFMKIQLPVV----MHTEAEDVSLRFRSQRAYG-------ILMATTSRDSADTLRLELDAGRVKLTVNLGKG-------PETLFAGYNLNDNEWHTVRVVRRG-KSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGLSSVPSNFIGHLQSLTFNGMAYID............................................................................................................................................................................................................ 161
43 -13.4001qu0_A mol:protein length:191 LAMININ ALPHA2 CHAIN  ali model follow..  12  9............................................SGTYFDG-TGFAKAVGGFKV-----GLDLLVEFEFRTTRPTG--------VLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIY---DAEIPGHMCNGQWHKVTAKKIK-NRLELVVDGNQVDAQSPNSSTSADTNDPVFVGGLTTNIRFRGCIRSLKLTKGTGKPLEVN........................................................................................................................................................................................................ 173
44 -13.4002r1b_A mol:protein length:220 Neurexin-1-beta  ali model follow..  10...........................................GTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGF--------STVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDD------IAIEESNAIINDGKYHVVRFTRSG-GNATLQVDSWPVIERYPAGNNDARQRIPYRLGGKEQGQPFQGQLSGLYY-----NGLKVLNMAAENDANIAI............................................................................................................................................................................................ 207
45 -13.3001urx_A mol:protein length:282 BETA-AGARASE A  ali model follow..  24LQDNVSD------SFNYTSSEGNR-APQAWTNGSQLAIQAQPAGNGKSYNGSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQSIDIMEGY-----GSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQAADDSKNIFWVDWIRVYKPVAVSLE.......................................................................................................................................................................................................... 276
46 -13.1001d2s_A mol:protein length:170 SEX HORMONE-BINDING GLOBULIN  ali model follow..  12.................................................QEPIAVMTFDLTK-------ITKTSSSFEVRTWDPEG-------VIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWA-------QLTVGAGPRLDDGRWHQVEVKMEG-DSVLLEVDGEEVLRLRQVS---GHPIMRIALGRLPLVPALDGCLRRDSWLDKQAEISASAP....................................................................................................................................................................................................... 164
47 -12.8001f5f_A mol:protein length:205 SEX HORMONE-BINDING GLOBULIN  ali model follow..  24.................................................QEPIAVMTFDLTK-------ITKTSSSFEVRTWDPEG-------VIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWA-------QLTVGAGPRLDDGRWHQVEVKMEG-DSVLLEVDGEEVLRLRQVSTSKRHPIMRIALGRLPLVPALDGCLRRDSWLDKQAEISASAP....................................................................................................................................................................................................... 182
48 -12.7001o4y_A mol:protein length:288 beta-agarase A  ali model follow..  24LQDNVSD------SFNYTSSEGNR-APQAWTNGSQLAIQAQPAGNGKSYNGSKNKIQYPVYMEIKAKIMDQVLANAFWTLTDDETQEIDIMEGY-----GSDRGGTWFAQRMHLSHHTFIRNPFTDYQPMGDATWYYNGGTPWRSAYHRYGCYWKDPFTLEYYIDGVKVRTVTRAEIDPNNHLGGTGLNQAADDSKNIFWVDWIRVYKPV-GNNSLE........................................................................................................................................................................................................ 282
49 -12.5003sh4_A mol:protein length:195 LG3 peptide  ali model follow..  11..................................................HDDGFLAFP-GHVFSRSLPEVPETIELEVRTSTASG---LLWQGVEVGEAGQGKDFISLGLQDGHLVFRYQLGSG-------EARLVSEDPINDGEWHRVTALREG-RRGSIQVDGELVSGRSPGPNVAVNAKGSVYIGGGRFSSGITGCVKNLVLHSARPGAPP.......................................................................................................................................................................................................... 174
50 -12.5003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  808......IGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGRNIIADPVTFKTKSSYVALATLQA------YTSMHLFFQFKTTSLDG--------LILYNSGDGNDFIVVELVKGYLHYVFDLGNGANL------KGSSNKPLNDNQWHNVMISRDT-SNLHTVKIDTKITTQITAGARNLDLKSDLYIGLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERG------------EGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQG------------------KIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNAT-----LQVDS..... 1172
51 -12.5001pz7_A mol:protein length:204 Agrin  ali model follow..  1...............EKVIIEKAAGDAEAIAFDGRTYME---HNAVTKSPDALDYPAEPSEKA------LQSNHFELSIKTEATQG------LILWSGKGLERSDYIALAIVDGFVQMMYDLGSK-------PVVLRSTVPINTNHWTHIKAYRVQ-REGSLQVGNEPITGSSPLGATQLDTDGALWLGPKAYSTGFIGCIRDVHLVEDALNNPTILH....................................................................................................................................................................................................... 200
52 -12.4001q56_A mol:protein length:195 Agrin  ali model follow..  3................................EKVIIEKAAGDAEAIAFDG-RTYMEYHNAVTKS-EKALQSNHFELSIKTEATQG------LILWSGKGLERSDYIALAIVDGFVQMMYDLGSK-------PVVLRSTVPINTNHWTHIKAYRVQ-REGSLQVGNEAPITGSSPLATQLDTDGALWLGPKAYSTGFIGCIRDVIV-EDALNNPTILH....................................................................................................................................................................................................... 191
53 -12.4001sli_A mol:protein length:679 INTRAMOLECULAR TRANS-SIALIDASE  ali model follow..  13  16...................................................EGQGYSLDQEAGAKYVKAMTQGTIILSYKSTSENGIQSLFSVGNSTAGNQDRHFHIYIT-NSGGIGIELRNTDGVFNYTLDRPASVRALYKGERVFNTVALKADANKQCRLFANGELLATLDKDAISDITGVDNVTLGGTKRQGKFGGTIGDIKVYSNALSDEELIQATGVTTYGENI............................................................................................................................................................................................ 200
54 -11.8004yz1_A mol:protein length:677 Putative neuraminidase  ali model follow..  12  1...............................MASSGLEVLFQGPNTPVLEKNNVTLTENVTKELKDKFTSGDFTVVIKYNQSSEKGLQALFGISN--SKPGQQNSYVDVFLDNGELGMEARDTSSNKNNLVSRPASVWGKYKQEAVTNTVAVVADSKKTYSLYANGTKVVEKKVDNIKDIKGIDYYMLGGVKRAGKFNGTLENIKFFNSALDEETVKKMTTNAVTGHLI............................................................................................................................................................................................ 208
55 -11.8001oq1_A mol:protein length:223 Protein yesU  ali model follow..  10........CLYRNPLRSKSDVKMEGGGQISFDDHSLHLSHVQDEAHFVFWCPETF--------------PDGIIVTWDFSPIEQPGLCMLFRGEDLFDPSLRKRTGTYPEYHSGDIN-TCNLRKSRGFHLAAMGADPLPSPDDADSPYRMKLIKDK-GYVHFSINGLPILEWMDDGSTYGPVLTKGKIGFRQMAPM-KAVYRDFAVHQ--AVRR........................................................................................................................................................................................................... 223
56 -11.8002zzj_A mol:protein length:238 Glucuronan lyase A  ali model follow..  14  6.....NDGHLNGWDYVRKENQGTVSEVSNVVFKGTSALKMTQTYTPGYTGRYHSEVDHNRGYQ---RGEEQFYGFAFRLSEDWQFQPQSYNIAQFIANRPGAGCGGTMIWIQNNQLYSRYVNGHYRQPNCGRNIVTRPNLTVSAGAWHRVVLQIDNTGYFKIWFDGAKVEEYNVATTVDDDSVFQFRVGMTGTQGFRQVWYDEVAV---GTTFADVD........................................................................................................................................................................................................ 234
57 -11.7001pz8_A mol:protein length:201 Agrin  ali model follow..  1................................EKVIIEKAAGDAEAIAFDG-RTYMEYHNAVTKSHLKALQSNHFELSIKTEATQG-------ILWSGKGLERSDYIALAIVDGFVQMMYDLGSK-------PVVLRSTVPINTNHWTHIKAYRVQ-REGSLQVGNEAPITGSSPLATQLDTDGALWLGPKAYSTGFIGCIRDVIVDRQELHLVE.......................................................................................................................................................................................................... 187
58 -11.7003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  8..............................................VTFKTKSSYVALAT-------QAYTSMHLFFQFKTTSLDG--------LILYNSGDGNDFIVVELVKGYLHYVFDLGNGAN-----LIKGSSNKPLNDNQWHNVMISRDT-SNLHTVKIDTKITTQITAGARNLDLKSDLYIGLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERG------------EGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQG------------------KIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNAT-----LQVDS..... 331
59 -11.6003pve_A mol:protein length:189 Agrin, Agrin protein  ali model follow..  15..................................................NGFSYLELKGLHTFE-RDLGEKMALEMVFLARGPSG---------NGQKTDGKGDFVSLALHNRHLEFRYDLGKG-------AAIIRSKEPIALGTWVRVFLERNG-RKGALQVGDGRVLGESPVPHTMLNLKEPLYVGGAAVASGFDGAIQLVLTQEHVLRAVDVAP....................................................................................................................................................................................................... 186
60 -11.5003v64_A mol:protein length:191 Low-density lipoprotein receptor-related prot  ali model follow..  3............................................ETLAFDG-RTYIEYLNAVIESELKALQSNHFELSLRTEATQG-------VLWIGKAAERADYMALAIVDGHLQLSYDLGSQ-------PVVLRSTVKVNTNRWLRIRAHREH-REGSLQVGNEAPVTGSSPLATQLDTDGALWLGPKAYGTGFVGCLRDVVVGHRQLHLLE.......................................................................................................................................................................................................... 177
61 -11.2004ate_A mol:protein length:266 BETA-PORPHYRANASE A  ali model follow..  10  14KVEQLSD------EFNGNSIDTNEGRAPSNFKKGNAFVSDGFLNLRSTLRKEPSSVQDPFKDEARFKASSLSMTSSFWFRVGQFSEIDVIEHIGNPSKENRQDDLPYQYHVN--------THYYGKHAGLQPLGTEYKMPGRGRDNFYTYGFWWKSPNELLFYFNGKQVMRIVPRVPLDEELRMIFDTEVFPDNSKNTMKVDWVRVYKLV............................................................................................................................................................................................................... 256
62 -11.2003wz1_A mol:protein length:282 Agarase  ali model follow..  28.............DFNYEAPAAGK-PHYSYVSGGKLAITSGRKPGTNQVYLSKAPLTYPVYMEARAKLSNMVLASDFWFLSADSTEEIDVIE---AYGSDRPGQEWYAERLHLSHHVFIRDPFQDYQPTDAGSWYADGKGTKWRDAFHRVGVYWRDPWHLEYYVDGKLVRTVSGQDIIDLSKPMYAIINMEADPNRNTYYVDWVRFYKPVPINGNAT........................................................................................................................................................................................................ 282
63 -11.1004b1m_A mol:protein length:185 LEVANASE  ali model follow..  15.............PFMSN-MTGWTTVNGTWADTIEGKQGRSDGDSFILSSAS------------------SDFTYESDITIKDGNGRGAG----LMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVI----AEYKTPIDVNKKYHLKTEAEGD-RFKIYLDDRLVIDAHDSVFSE-------QFGLNVWDA--TAVFQNVTK................................................................................................................................................................................................................... 173
64 -11.1003s5q_A mol:protein length:214 Putative glycosylhydrolase  ali model follow..  10  1...............................MGSDKIENLYFQGYRPLFDKDNGILTATADQSIWTKVQYENFILDLEFKTDVNTNSGVVIY---CTDKGNWIPSSIEIQIADDHHPEWQSYPEYWRCGSIYGHKGANEQLVKPGEWNRMIITAKG-QQIDIELNGKHIVSANLADWTSGTTNPDGTLPIPYANMPTKGYIGESNIWFRNIQLKQL......................................................................................................................................................................................................... 208
65 -11.0004atf_A mol:protein length:308 BETA-AGARASE B  ali model follow..  31.............NFEYEAPADNKGSDRSYVADGELKMWATRKPGSDKINMSKTRVVYPVYIEARAKVMNSTLASDVWLLSADDTQEIDILDAYGADYSESAGKDHSYFSKKVHISHHVFIRDPFQDYQPKDAGSWFEDGTVWNKEFHRFGVYWRDPWHLEYYIDGVLVRTVSGKDIIDLNKEMDIIINTESNIENNTFGVDWIRIYKPV---EKL......................................................................................................................................................................................................... 302
66 -11.0001mr5_A mol:protein length:648 trans-sialidase  ali model follow..  10  421..AVTTVGLVGFLSATKTEWEDA---CVNASTANAERVPNG-----LKFAGVGGGALWPQGQNQRYHFANHAFTLVASVTIHEVPKGAS----------------GASLDSSGGKKLLGLSYDKRHQWQPIYG----STPVTPTGSWYHVVLTMA-NKIGSVYIDGEPLEGSGQTVVPDERTPSHFYVGGYKRSGMPTDTVNNVLLYNRQLNAEEIRTLFLSQDL................................................................................................................................................................................................ 634
67 -11.0001dyk_A mol:protein length:394 LAMININ ALPHA 2 CHAIN  ali model follow..  5...........SVPTPAFPFPVPTMVHGPCVAESEPALLTG--SKQFGLSR-NSHIAIAFDDT----KVKNRLTIELEVRTEAESG-------LLFYMARINHADFATVQLRNGFPYFSYDLGSG-------DTSTMIPTKINDGQWHKIKIVRVK-QEGILYVDDASSQTISPKKADILDVVGILYVGIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGT................................................................................................................................................................................................. 205
68 -10.9003juu_A mol:protein length:280 porphyranase B  ali model follow..  10  23LIENMSD------EFEGKKIDEKK-LAENISLNNGSLQITTTMLPEPIVKNNKTYTHGGGYVECEMKANKTFMSSTFWLINEGKDRTTELDIQESVGQITNDADWMKYFDQTMNSNTHSRNIPEGCEYEKGSSKGKAELGGKAYEDFHVYGVWWKSKDEIIFFLDGKMQSKVTPPADFDIEMYLRMVVGMTGSKEDRTTTYNWVRSWQLVDSKN........................................................................................................................................................................................................... 274
69 -10.9002a75_A mol:protein length:652 sialidase  ali model follow..  423...VPTAGLVGFLSANGSVWEDV---CVDANVANAERVPNG-----LKFNGVGGGAVWPQGQTRRYQFANYRFTLVATVTIDELPKGTS----------------GAGLEGPGDAKLLGLSYDKNRQWRPLYG----AAPASPTGSWYHVVLTMAD-RQGSVYVDGQPLAGSGNTVVRGATLPSHFYIGGPRSKGAPTDTVTNVVLYNRRLNSSEIRTLFLSQDM................................................................................................................................................................................................ 635
70 -10.9001h6y_A mol:protein length:170 ENDO-1,4-BETA-XYLANASE Y  ali model follow..  1MEEPDANGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKGS--ESLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQR-----------------------------YDTIDMKTVGPNQWVHLYNPQSDATDMYVYVATADDTIN---------------------------YIDEAIGAVAGTVIEG.......................................................................................................................................................................................................... 162
71 -10.8004q8k_A mol:protein length:375 Alginase  ali model follow..  10  2........TINNAGFE-------SGFSNWNETDPAAISSDAYSGSSLKIQGSPQVVDI---------QPNTEYTLSAYVLGKGQIGVND-------------------------------------------LNGLFKNQTFNVSSWTKVTKTFTNTNSLQVFAKHYNNTSD----------------------------FDNFSLIEGSGSND........................................................................................................................................................................................................... 129
72 -10.7001h6x_A mol:protein length:170 ENDO-1,4-BETA-XYLANASE Y  ali model follow..  1MEEPDANGYYYHDTFEGSVGQWTAAGPAEVLLSGRTAYKGS--ESLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQR-----------------------------YDTIDMKTVGPNQWVHLYNPQSDATDMYVYVETADDTIN---------------------------YIDEAIGAVAGTVIEG.......................................................................................................................................................................................................... 162
73 -10.7003ilf_A mol:protein length:268 porphyranase A  ali model follow..  10  16KVEQLSD------EFDGNSIDTNK-KGDAFVSDGFLNLRSTLRKEPSSVQDPFKDIWVDAAAEARFMASSLSMTSSFWFRVGQFSSIDVIEHIGDPSKENRQDDLPYQYHVN--------THYYGKHAGLQPLGTEYKMPGRGRDNFYTYGFWWKSPNELLFYFNGKQVMRIVPRVPLDEELRMIFDTEVFPDNSKNTMKVDWVRVYKLV............................................................................................................................................................................................................... 258
74 -10.6001wcs_A mol:protein length:641 SIALIDASE  ali model follow..  419....PTAGLVGFLSANGSVWEDV---CVDANVANAERVPNG-----LKFNGVGGGAVWPQGQTRRYQFANYRFTLVATVTIDELPKGTS----------------GAGLEGPGDAKLLGLSYDKNRQWRPLYG----AAPASPTGSWYHVVLTMAD-RQGSVYVDGQPLAGSGNTVVRGATLPSHFYIGGPRSKGAPTDTVTNVVLYNRRLNSSEIRTLFLSQDM................................................................................................................................................................................................ 630
75 -10.6004azz_A mol:protein length:172 LEVANASE  ali model follow..  4.............PFMSN-MTGWTTVNGTWADTIEGKQGRSDGDSFILSSAS------------------SDFTYESDITIKDGNGRGAGA---LMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVI----AEYKTPIDVNKKYHLKTEAEGD-RFKIYLDDRLVIDAHDSVFSE-------------------GQFG-LNVWDATAVFQNVT........................................................................................................................................................................................................ 161

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 1 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.