current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MAMGTLEAQTQGPGSMDKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMSLast
1 -114.0003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model  100  1MAMGTLEAQTQGPGSMDKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS 264
2 -111.0003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  56  1.................MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYMA 247
3 -111.0004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  59  5.....VDLGTENLYFQSMSLQGKVALVTGASRGIGQAIALELGRLGAVVIGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYMS 263
4 -109.0004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  60  1..............MSTQDLSGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWG--GEGRVLNSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQRAGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLMP 248
5 -108.0001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  60  1.................MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM. 243
6 -108.0005cdy_A mol:protein length:244 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  61  1.................MSFEGKIALVTGASRGIGRAIAELLVERGACVIGTATSEKGAEAISAYL---GENGKGLMLNVVDPTSIDTVLATIRAEFGEVDILVNNAGITRDNLLMRMKDDEWQDIIDTNLTSVFRLSKAVMRAMMKKRFGRIITIGSVVGTMGNAGQVNYAAAKAGVIGFSKSLAREVASRGITVNVVAPGFIETDMTRTLTDDQRAGILAQVPANRLGDAKEIASAVAFLASDEASYISGETLHVNGGMYM. 243
7 -108.0003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  60  1..........SNAMSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL---GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM. 250
8 -105.0003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  48  4...............SMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL---GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM. 248
9 -105.0003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  50  1MAMGTLEAQTQGPGSM-FKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL---GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLNEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM. 259
10 -104.0003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  50  1..............MAMIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNAL---KDNYTIEVCNLANKEECSNLIS----KTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM. 242
11 -104.0002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  40  22.........ENKKENYYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGL... 273
12 -104.0003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  54  2...................SMTKSALVTGASRGIGRSIALQLAEEGYNVVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM. 246
13 -103.0002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  52  1..................MLKGKVALVTGASRGIGRAIAIDLAKQGANVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM. 246
14 -103.0002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  46  1...............MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF.. 248
15 -103.0002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  42  1.................MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANILNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM. 247
16 -103.0004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  38  18................AMQFTGKNVLITGASKGIGAEIAKTLASMGLKVINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNVASIIGERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM. 265
17 -102.0004jro_A mol:protein length:271 FabG protein  ali model follow..  52  18................AMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM. 265
18 -101.0002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  54  2......................RKALITGASRGIGRAIALRLAEDGFALIHYGQNREKAEEVAEEARRRGSPLVAVGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKARFGRIVNITSVVGILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTPH 245
19 -101.0001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  47  1.....................SPVVVVTGASRGIGKAIALSLGKAGCKVVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI. 244
20 -100.0004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  40  1.................MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL. 246
21 -100.0003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  38  1...............MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHMG 250
22 -100.0003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  40  1..............MRGSGSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHMG 251
23 -99.5004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  47  1.................MSTDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKYGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVVG 256
24 -99.4003woh_A mol:protein length:251 SiaM  ali model follow..  41  1...........GSMTGPGALSGKVALVTGGSRGLGRAMALRLARDGAAVIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKRSGSIINISSVSGVFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK--RLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM. 251
25 -99.3002cf2_E mol:protein length:226 FATTY ACID SYNTHASE, KR DOMAIN  ali model follow..  59  1.................MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL---GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITI---------GGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETSDD------QRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM... 226
26 -99.2004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  41  1..............MLSLGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATDGG----------NTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYERKAGSIVAISSISGERGNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPVASYVTGEVLRVNGAHH.. 239
27 -98.5004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  39  13.............LYFQGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHMG 264
28 -98.2004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  41  1.................MAMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGWGRIVNISSVNGSKGSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILDTILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQHM. 248
29 -97.7002nm0_A mol:protein length:253 Probable 3-oxacyl-(Acyl-carrier-protein) redu  ali model follow..  43  1.......MGSSSSGLVPRSHMSRSVLVTGGNRGIGLAIARAFADAGDKVAITYRSGEPPEGF-----------LAVKCDITDTEQVEQAYKEIEETHGPVEVLIANAGVTKDQLLMRMSEEDFTSVVETNLTGTFRVVKRANRAMLRAKKGRVVLISSVVGLLGSAGQANYAASKAGLVGFARSLARELGSRNITFNVVAPGFVDTDMTKVLTDEQRANIVSQVPLGRYARPEEIAATVRFLASDDASYITGAVIPVDGGLGMG 246
30 -97.5004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  49  1MGSSSSGLVPRGSHMTALPLTDRIALVTGASRGIGRAIALELAAAGAKVVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQRSGRIINIASVVGEMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAAE---KLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVMA 263
31 -97.4004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  43  1...............MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVV-----ADFNEAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM. 244
32 -97.3004kms_A mol:protein length:249 Acetoacetyl-CoA reductase  ali model follow..  43  1..................MAMSEIAIVTGGTRGIGKATALELKNKGLTVVANFFSNYDAAKEMEE----KYGIKTKCWNVADFEECRQAVKEIEEEFKKVSILVNNAGITKDKMLHRMSHQDWNDVINVNLNSCFNMSSSVMEQMRNQDYGRIVNISSINAQAGQVGQTNYSAAKAGIIGFTKALARETASKNITVNCIAPGYIATEMVGAVPEDVLAKIINSIPKKRLGQPEEIARAVAFLVDENAGFITGETISINGGHNM. 242
33 -97.3003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  42  13...............PGSMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVASHSERNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEAILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHMS 263
34 -97.3004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  51  1................MTALTAQVALVTGASRGIGKATALALAATGMKVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNAE---PILQFIPLARYGQPEEVAGTIRFLATDPAAYITGQTFNVDGGMVM. 246
35 -97.3001uzl_A mol:protein length:247 3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE  ali model follow..  41  11.................PPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPK-----------GLFGVECDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMG 246
36 -97.2004cql_B mol:protein length:244 CARBONYL REDUCTASE FAMILY MEMBER 4  ali model follow..  41  1...................MMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDL---GGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEE---HLKKNIPLGRFGETIEVAHAVVFLLE--SPYITGHVLVVDGGLQLI 237
37 -96.9001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  36  1.................MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAV-----GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVY-LGNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTIG 241
38 -96.3004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  45  1................MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGD---------LTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL. 240
39 -96.2002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  43  1...............MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFMA 258
40 -96.1004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  43  5...............LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM. 261
41 -95.9001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  37  1..MGSSSSGLVPRGSHMATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKGMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN. 274
42 -95.5002ntn_A mol:protein length:267 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  41  25.................PPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKG-----------LFGVEVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIASVSGLWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMG 260
43 -95.5004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  35  14................MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAYR.. 261
44 -94.6004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  38  1..MSSGVDLGTENLYFQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGRIITLSSVSGVMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKE-AMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML.. 261
45 -94.1003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  38  1................TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI---GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAKAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVR. 246
46 -93.0003sju_A mol:protein length:279 Keto reductase  ali model follow..  38  13................SHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRGMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGN. 272
47 -92.1004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  32  4....ELTEITPESLRLRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVAGKTYSIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYMA 267
48 -91.2003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  37  1MAMGTLEAQTQGPGSVMFDLSARSVLVTGGTKGIGRGIATVFARAGANVVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGRGRVILTSSITGVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVL. 278
49 -91.0004yxf_A mol:protein length:257 MupS  ali model follow..  29  3...DAVSDALHTRHDSAPSAVKGTIIVSGGSQGLGLTTVRCFLEAGYNVATFSRRESPAVTELSE----RADFHWQALDCTDYSALTAFVQQVEKRFGGLDGLVNNAATGVEGILSTMRVADIDSALDINLKGQLYLTKLVTAKLLKRGAGSVVNVSSINALRGHSGLTVYSATKAAMDGLTRSLAKELGPRGIRVNSVSPGYFSSDMVKDLSPQTLSRIERRTPLGRLGTQQEVADLILYLVDR-GTFVTGQNIAVDGGFTC. 257
50 -90.9003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  33  4...............SMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL. 253
51 -90.1003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  41  7................PFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKP-FDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE 254
52 -90.0003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  29  1...............MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV. 253
53 -89.6004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  35  1.............MAMTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKRHQLTLIPQGRAQTPEDMGRLALFFATMD--NVTGQAVNVDGGFTFH 260
54 -88.8004qec_A mol:protein length:248 ElxO  ali model follow..  31  2.....................KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLS. 247
55 -88.4003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  33  4................SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTA---AWLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII. 251
56 -88.3003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  30  1..................MEQNKCALVTGSSRGVGKAAAIRLAENGYNIINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL. 248
57 -87.9005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  32  1................MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFALG 252
58 -87.7001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  6................NLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKP-FDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE 253
59 -87.6002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  32  1...............MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIA--IADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVR. 248
60 -87.4003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  34  2...........SHMAGIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD 263
61 -87.4005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  34  2................MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVP-ALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA 251
62 -86.3003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  35  1.............MGMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTK. 254
63 -86.3002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  35  1................MGRLSGKTILVTGAASGIGRAALDLFAREGASLV----VDREERLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVL--EEGGSLVLTGSVAG-LGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV 242
64 -86.2001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  36  1...............MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTL. 252
65 -86.2001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  36  1...............MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQ. 252
66 -85.9003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  1MSSGVDLGTENLYFQSMQGFEGKVALVTGAAGGIGGAVVTALRAAGARVA-----------VADRAVAGIAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAVA 260
67 -85.3003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  32  1..............MKPYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQRGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRADAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREEARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGGLSR. 263
68 -85.2002fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena  ali model follow..  29  3.................MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQA----------FTQEQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWRGFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTLG 249
69 -85.2004o6v_A mol:protein length:242 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  31  1................MAMTIQKVAIITAGGSGMGAASARRLAQDGFAVAILSSSGKGEALAKE-------GGIGVTGSNQSNDDLQKLVDQTLEKWGRIDVLVNSAGHGPRAPILEITDEDWHKGMDTYFLNAVRPARLVVPAMQKQKSGVIINISTAWAFEPSAMFPTSAVFRAGLASFTKIFADTYAAENIRMNNVLPGWIDSLPT-------TEERRESVPMQRYGKSEEIAATVSFLASDGAAYITGQNLRVDGGLTRS 235
70 -84.8003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  34  20...................LKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVHGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQR... 265
71 -84.8004one_A mol:protein length:262 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  29  1...............MAMSRQRPVALVTGGRRGIGLGIARALAAKGFDLA--ITDRESDEAVIHELRGLGGKVAFFKSDLAAVKTHEATVFAVLDAFGGIDCLVNNAGMVERGDFLALKPENFDTIMDVNLRGTVFFTQAVVKAMLAADEVRIVTISSVSSVMTSPERLDYCISKAGLTAFVQGLALRLAEARIGVFEVRPGIIRTDMTAKVAARYDALIEGLVPMKRWGEASDVGAIVAGLAGGDFIFATGSAIHADGGLSIA 254
72 -84.8001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  24  2......................STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELE------AFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM. 245
73 -84.7003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  24  2......................STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELE------AFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM. 245
74 -84.6004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  30  1...............MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAQTSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYK. 257
75 -84.5004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  36  1..............MAMSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEG--ASIINISSVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSIGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDDARWMTGEHLVVSGGL... 249

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.