current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3edm_A mol:protein length:259 Short chain dehydrogenase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MSLQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGMISTTFHDTFTKPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVLFSEGLast
1 -112.0003edm_A mol:protein length:259 Short chain dehydrogenase  ali model  100  1MSLQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGMISTTFHDTFTKPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVLFSEG 253
2 -105.0004yqy_A mol:protein length:270 Putative Dehydrogenase  ali model follow..  56  14FQSMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEGSSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPKIRVNSLCPGMIDTDFHNIFTKPEVRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLFS.. 264
3 -96.5004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  33  2..FSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDIRFNIVAPGTVDTAFHADKS-DELKTRIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQIC... 257
4 -96.1004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  32  2..FSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDIRFNIVAPGTVDTAFHADKS-DELKTRIANSIPMGRFGTVQELAPAYVFFASHAASYITGQILDVNGGQIC... 257
5 -95.0004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  32  2..FPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAASAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDVRFNIVSPGTVDTAFHADKT-QDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYK... 257
6 -95.0003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  33  2..FPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAASAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDVRFNIVSPGTVDTAFHADKT-QDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGGQYK... 257
7 -90.9003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  28  4.SMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAG-VFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHITVNAIMPGNIMTEGLLENG-EEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPES 256
8 -90.4002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  35  2.....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAG-VTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQGRIVNIASVVGVTG-NPGQANYVAAKAGVIGLTKTSAKELASRITVNAIAPGFIATDMTDVL-DENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM... 246
9 -90.1002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  36  1...MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAG-ITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQGKIINITSIAGIIG-NAGQANYAASKAGLIGFTKSIAKEFAAKIYCNAVAPGIIKTDMTDVL-PDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM... 247
10 -90.0004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  33  1MAMSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSG-VYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEGASIINISSVVTSIT-PPASAVYSGTKGAVDAITGVLALELGPRIRVNAINPGMIVTEGTHSAGGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDDARWMTGEHLVVSGGL..... 249
11 -89.7004jro_A mol:protein length:271 FabG protein  ali model follow..  34  17.NAMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAG-ITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQGKIINMASVVGLIG-NAGQANYVASKAGVIGLTKTTARELAPRINVNAVAPGFITTDMTDKL-DEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM... 265
12 -89.7003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  37  2.....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQGAIINLSSVVGAVG-NPGQANYVATKAGVIGLTKSAARELASRITVNAVAPGFIVSDMTDAL-SDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM... 246
13 -89.5003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  36  6.SPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDL-KSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAG--GGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKGGAILNISSMAGENT-NVRMASYGSSKAAVNHLTRNIAFDVGPMIRVNAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE.. 254
14 -89.4004e3z_A mol:protein length:272 Putative oxidoreductase protein  ali model follow..  38  18.....SDTPVVLVTGGSRGIGAAVCRLAARQGWRVGVNYAANREAADAVVAAITESGGEAVAIPGDVGNAADIAAMFSAVDRQFGRLDGLVNNAGIVDYPQRVDEMSVERIERMLRVNVTGSILCAAEAVRRMSQGGAIVNVSSMAAILGSATQYVDYAASKAAIDTFTIGLAREVAAEIRVNAVRPGIIETDLHASGGLPDRAREMAPSVPMQRAGMPEEVADAILYLLSPSASYVTGSILNVSGG...... 265
15 -89.3004iqg_C mol:protein length:271 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  12LYFQSMLSKVVLITGGSRGIGAASALLAARQGYAVAVNYASNSAAADEVVRQIREAGGQALAVQADVAKEREVLAMFETVDAQLGRLSALVNNAGVVDQTTRVDGITLERLQRMFEINVFGSFLCAREAVKRMSSGGSIVNVSSAAARLGSPGQYVDYAAAKGAIDTFTLGLAKEVATEIRVNAVRPGIIETDIHASGGLPNRARDVAPQVPMQRAGTAREVAEAIVWLLGDQASYTTGALLDVTGG...... 264
16 -88.8004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  32  17.NAMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAG-VVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSGSVVNVASIIGERG-NMGQTNYSASKGGMIAMSKSFAYEGALRIRFNSVTPGFIETDMNANL-KDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM... 265
17 -88.7003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  30  2.....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAA-SGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKGGHIVSISSLGSIRY-LENYTTVGVSKAALEALTRYLAVELSPKIIVNAVSGGAIDTDALKHFNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL... 248
18 -88.5004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  35  1...MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCD-VQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAG-ITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGVILNASSVVGLYG-NFGQTNYAASKFGVIGFTKTWARELGPKVRVNAVCPGFVNTEILQTV-PDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL... 246
19 -88.4001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  34  1.......SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAG-ITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKGRIINIASVVGLIG-NIGQANYAAAKAGVIGFSKTAAREGASRINVNVVCPGFIASDMTAKL-GEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI... 244
20 -88.4005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  32  1..MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAAR-SEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNLDKNLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKGGSIVNISTIGSVVP-DISRIAYCVSKSAINSLTQNIALQYARKIRCNAVLPGLIGTRAALENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFALG.. 252
21 -88.3004jig_A mol:protein length:261 Dehydrogenase  ali model follow..  36  5...ASSDRKAVLITGASRGIGRATAVLAAERGWDVGINYARDAAAAELTAQAVRDAGGRACIVAGDVANEADVVAMFDTVAAAFGRLDALVNNAGIVAPSMPLADMPVDRLRRMFDTNVLGAYLCAREAARRLSRGGAIVNVSSIASRLGSPNEYVDYAGSKGAVDSLTIGLAKELGPHVRVNAVRPGLIETDIHASGGQPGRAARLGAQTPLGRAGEAQEVAEAIVWLLGDTASYTTGALLDVGGG...... 254
22 -88.3004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  28  4..GGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAG-LTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRREGAIVNVSSMSSMGG-QPFIAAYCASKGALDTLTRNVAYSVLRNIRVNSLNIGWMASDGEDRIAPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWGA.. 260
23 -88.2003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  30  3.GSMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADI-NAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIFMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKGGAIVNQSSTAA----WLYSNYYGLAKVGINGLTQQLSRELGGRIRINAIAPGPIDTEANRTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII... 251
24 -88.2005iz4_A mol:protein length:271 Putative short-chain dehydrogenase/reductase  ali model follow..  30  1MAMTQSSTPVCVITGSASGIGAATALRFAQAGWSVAIGNDSTRDAASTVEALCRDAGAQTLIFDADVGKDADCRHAVDMVASRWQRIDALINCAG-VIPHNAFDQIDDFEFERVYRVNLIGLYQMTRAAVPLLRESTSVVNVSSLAGLNG-TGSSIAYAASKGAVNTLTLSLARNLAPHIRVNALAPGMVDDGLLLRVAYDGVLSRMTESAPLKRVSRPAEIAELAWFLTAH-APAITGQVIAAENGLLLGGA 265
25 -88.1002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  31  2..QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAG-ITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGSIINISSIVGKVG-NVGQTNYAASKAGVIGLTQTAARELGRHIRCNSVLPGFIATPMTQKV-PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFMAE. 259
26 -87.8004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  31  6..QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAG-ITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGSIINISSIVGKVG-NVGQTNYAASKAGVIGLTQTAARELGRHIRCNSVLPGFIATPMTQKV-PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM... 261
27 -87.8003woh_A mol:protein length:251 SiaM  ali model follow..  30  5.GPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAG-IIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRKGSIINISSVSGVFG-SAGQANYASAKAGLIGLTKSIAKELAERVRCNAVAPGLIATDMTQDLVDD---SKRLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM... 251
28 -87.7003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  25  7...GLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAAR-TVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVPSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEESGAVVNVNSMVVRHS-QAKYGAYKMAKSALLAMSQTLATELGEKIRVNSVLPGYIWGGTLKSYSVEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCGEYKA.. 264
29 -87.5001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  32  3...KDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAG-LENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVEKGTVINMSSVHEKIP-WPLFVHYAASKGGMKLMTKTLALEYAPKIRVNNIGPGAINTPINAEKADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTLYPS 255
30 -87.4001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  4SDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAG--GGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKGGVILTITSMAAENK-NINMTSYASSKAAASHLVRNMAFDLGEKIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE.. 253
31 -87.4004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  29  15..QSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAG-IARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGGGRIITLSSVSGVMG-NRGQVNYSAAKAGIIGATKALAIELAKRITVNCIAPGLIDTGMIEME--ESALKEAMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML.... 261
32 -87.4003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  25  3...LGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAG-VFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQGRIINYGQGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYITANMVCPGDIIGEMKEATI-QEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV... 253
33 -87.2001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  32  3...KDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAG-LANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVEKGTVINMSSVHEKIP-WPLFVHYAASKGGMKLMTETLALEYAPKIRVNNIGPGAINTPINAEKADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQYPS 255
34 -87.2003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  28  30..MFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAG-IFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTASGRVILTSSITGPVTGYPGWSHYGASKAAQLGFMRTAAIELAPRVTVNAILPGNILTEGLVDMG-EEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVLPES 281
35 -86.9003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  32  6.GIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADL-DVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAG-VSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASGVIVNTASLAAKVG-APLLAHYSASKFAVFGWTQALAREMAPKIRVNCVCPGFVKTAMQERMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD.. 263
36 -86.9003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  31  4..YTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAG-VENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVEKGNVINMSSVHEMIP-WPLFVHYAASKGGMKLMTETLALEYAPKIRVNNIGPGAMNTPINAEKADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPS 257
37 -86.9004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  32  1...MSTDKRVAIITGAANGIGRATALEFAQAGYHV-VAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAG-ILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAGRILNASSVVGLYG-NFGQTNYVAAKSGVIGMTKVWARELGRYITVNAIAPGFIATEMVQQM-PERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVVG.. 256
38 -86.7004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  32  14RLRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAG-ISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEAGWIVNTSSVAGKTYSPIVACHYAATKSAIIGFTKHLAAELGPYIRVNAMAPGRIATPMVAGV-APEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYMA.. 267
39 -86.1004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  36  1..MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAG-ITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQGRIINITSVAGMMG-NPGQANYSAAKAGVIGFTKTVAKELASRVTVNAVAPGFIATDMTENLNA----EPILQFIPLARYGQPEEVAGTIRFLATDPAAYITGQTFNVDGGMVM... 246
40 -85.7004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  33  1MSTQDLSGKIALVTGASRGIGAAIADTLAAAGAKV-IGTATSESGAAAISERLAQWGGEGRVL--NSAEPETVENLIADIEKTFGKLDILVNNAG-ITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQGRIINITSVVGVMG-NAGQTNYAAAKAGLIGFSKSMAREVGSRITVNCVAPGFIDTDMTRAL-PEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLMP.. 248
41 -85.5004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  31  1...MAMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAG-ITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVERGRIVNISSVNGSKG-SVGQTNYAAAKAGMHGFTKSLALEIARKVTVNTVSPGYLATKMVTAIPQDILDTKILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQHM... 248
42 -85.5004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  31  2..MSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN-----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAG-ITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKIINTSSVTGTYG-NVGQTNYAAAKAGVIGMTKTWAKELARKINVNAVAPGFTETAMVAEV-PEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM... 244
43 -85.4003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  30  1MRGSGSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAG-ITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGRIVNISSVNGQKG-QFGQTNYSTAKAGLHGFTMALAQEVATKVTVNTVSPGYIATDMVKAI-RQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHMG.. 251
44 -85.2004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  33  1..MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLG----------DLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAG-ITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGSIINISSVVGVFG-NIGQANYAATKAGVIGLTMTWAKEFALKVRVNAIAPGYIMTDILKTV-PQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL... 240
45 -85.1004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  29  13.GMNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFG-ETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAG-ITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAGVIINTASVTGIFG-SLSGVGYPASKASVIGLTHGLGREIIRKIRVVGVAPGVVNTDMTNGN-PPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY..... 260
46 -85.1003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  21  2........STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDE-------LEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRGHIIFITSAAPFGP-WKELSTYTSARAGASTLANALSKELGEYIPVFAIGPNYLHSEDSPYFTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIE. 247
47 -85.1004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  37  15MTALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAG-ITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQGRIINIASVVGEMG-NPGQANYSAAKAGVIGLTKTVAKELASRITVNAVAPGFIATDMTSELAA----EKLLEVIPLGRYGEAAEVAGVVRFLAADPAAYITGQVINIDGGLVMA.. 263
48 -85.1001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  21  2........STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDE-------LEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRGHIIFITSATPFGP-WKELSTYTSARAGACTLANALSKELGEYIPVFAIGPNYLHSEDSPYFTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM... 245
49 -85.1001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  29  1...MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADI-NLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAA-LFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGKIINMASQAGRRG-EALVGVYCATKAAVISLTQSAGLNLIRHINVNAIAPGVVDGEHWDGVDAGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS.. 256
50 -85.0005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  28  1.HMELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDI-DGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAGNVVHLCSVAGFVS-GGSTAGYVVSKGAIRSLTQVMARDLAPHIRVNAVAPGIMMSEMAVAQNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA.. 251
51 -85.0002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  34  3...IKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAG-ITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQGRIVNISSVVGFTG-NVGQVNYSTTKAGLIGFTKSLAKELAPRVLVNAVAPGFIETDMTAVL-SEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF.... 248
52 -85.0003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  29  3...MVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAG-ITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGRIINISSVNGQKG-QFGQTNYSTAKAGIHGFTMSLAQEVATKVTVNTVSPGYIGTDMVKAI-RPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHMG.. 250
53 -84.8002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  35  2........RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVAVGANLLEAEAATALVHQAAEVLGGLDTLVNNAG-ITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKAGRIVNITSVVGILG-NPGQANYVASKAGLIGFTRAVAKEYAQRITVNAVAPGFIETEMTERL-PQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTP... 244
54 -84.7003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  29  1...MSLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAG-ITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKGRIISIGSVVGSAG-NPGQTNYCAAKAGVIGFSKSLAYEVASRITVNVVAPGFIATDMTDKL-TDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYMA.. 247
55 -84.6003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  28  15...SMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAG-ITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERGRIVNIGSVNGSRG-AFGQANYASAKAGIHGFTKTLALETAKRITVNTVSPGYLATAMVEAVPQDVLEAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHMS.. 263
56 -84.5001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  31  3...KKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDM-NREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQGRIVNTASMAGVKG-PPNMAAYGTSKGAIIALTETAALDLAPYIRVNAISPGYMGPGFMWERQPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG...... 262
57 -84.5002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  30  8.RRKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSS-RKQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKGGSVLIVSSVGAYHP-FPNLGPYNVSKTALLGLTKNLAVELAPRIRVNCLAPGLIKTNFSQVLMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTAS... 258
58 -84.2004qec_A mol:protein length:248 ElxO  ali model follow..  27  2.......KKNVLITGGFKGIGKQVALEFLKNDYHVCITS-RYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKCGAIVNISSITGLSG-FPYSILYGSTKHAVIGLTKGAAVEFADKIKINAVAPGIIKTETLQKESGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGGYLSQ.. 248
59 -84.2003wtb_A mol:protein length:246 Putative oxidoreductase  ali model follow..  33  2...SHMTHRVALITGGSRGIGAAIALKLAQDGFDIAITYARNEKAAQKVVSEVEALGRKAVAVQADGGSTDGNIAAITKTHEAFGRLDALVCNAG-IYPYGPIAQMTVTQIEEVLNLNLRAAMVETVEALKYMKTGGRLIYIGSAFGERAPFPGISLYAATKAGLIGFTKGVARDLGPQITANVVEPGPIATDLNPEDG--AAAAVIRKFTATESYGKVNDIARTVSFLASPDASYITGASILVDGGLV.... 245
60 -84.2003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  33  9.RRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSS-RKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKGGSVVIVSSIAAFSP-SPGFSPYNVSKTALLGLTKTLAIELAPRIRVNCLAPGLIKTSFSRMLMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGT..... 257
61 -84.1004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  33  14FQSMSLQGKVALVTGASRGIGQAIALELGRLGAVV-IGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAG-ITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKAGRIINIGSVVGAMG-NAGQTNYAAAKAGLEGFTRALAREVGSRITVNAVAPGFIDTDMTREL-PEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYMS.. 263
62 -83.9003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  31  2...ERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAK----AAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNAS-IVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGRVISIASNTFFAG-TPNMAAYVAAKGGVIGFTRALATELGKYITANAVTPGLIESDGVKASPHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVR... 246
63 -83.9003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  33  15SMDKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAG-ITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKAGRIVNITSVVGSAG-NPGQVNYAAAKAGVAGMTRALAREIGSRITVNCVAPGFIDTDMTKGL-PQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFMS.. 264
64 -83.8002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  30  29..YYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAG-ITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNGRIINISSIVGLTG-NVGQANYSSSKAGVIGFTKSLAKELASRITVNAIAPGFISSDMTDKI-SEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGL..... 273
65 -83.7003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  32  2.......SKVAMVTGGAQGIGRGISEKLAADGFDIAVALPQQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAG-IAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDEKGKIINAASIAAIQG-FPILSAYSTTKFAVRGLTQAAAQELAPKHTVNAYAPGIVGTGMWEQIDAEENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLYN.. 258
66 -83.6004da9_A mol:protein length:280 Short-chain dehydrogenase/reductase  ali model follow..  26  18..MTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGASIVRDDFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLASRSIINITSVSAVMT-SPERLDYCMSKAGLAAFSQGLALRLAETIAVFEVRPGIIRSDMTAAVSGKYDGLIESGLVPMRRWGEPEDIGNIVAGLAGGQFGFATGSVIQADGGLSIGR. 273
67 -83.6004e4y_A mol:protein length:244 Short chain dehydrogenase family protein  ali model follow..  25  1....SNAMANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQSFS----------AENLKFIKADLTKQQDITNVLDII--KNVSFDGIFLNAG-ILIKGSIFDIDIESIKKVLDLNVWSSIYFIKGLENNLKVGASIVFNGSDQCFIA-KPNSFAYTLSKGAIAQMTKSLALDLAKYIRVNTVCPGTVDTDLYRNLSFDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDKSKFMTGGLIPIDGGYTAQ.. 244
68 -83.6004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  29  14YFQGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAG-ITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGRIVNISSVNGQKG-QFGQTNYSTAKAGLHGFTMALAQEVATKVTVNTVSPGYIATDMVKAI-RQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHMG.. 264
69 -83.5003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  32  2.SHMSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDV-KQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAG-ICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGKIINACSIAGHEG-YPLLGAYSATKFAVRALTQSAAKELASSITVNSYCPGIVGTDMWVTIDKRATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGGLVFR.. 262
70 -83.3002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  35  1..MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREE----RLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAG-VAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGL--GAFGLAHYAAGKLGVVGLARTLALELARKVRVNVLLPGLIQTPMTAGL-PPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV.. 242
71 -83.1001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  30  2.......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADY-NDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAG-VAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKGGKIINACSQAGHVG-NPELAVYSSSKFAVRGLTQTAARDLAPLITVNGYCPGIVKTPMWAEIDRQYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN.. 256
72 -83.1001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  34  1...MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDI-EEGPLREAAEAV-----GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAG-ITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKGSIVLTASRVYL--GNLGQANYAASMAGVVGLTRTLALELGRWIRVNTLAPGFIETRMTAKV-PEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTIG.. 241
73 -83.1001doh_A mol:protein length:283 TRIHYDROXYNAPHTHALENE REDUCTASE  ali model follow..  28  23.QSASLEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKNGSDAACVKANVGVVEDIVRMFEEAVKIFGKLDIVCSNSG-VVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKITVNVVAPGGIKTDMYHAVCEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM... 283
74 -82.9001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  31  9..TISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAG-VSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKGSIVVTSSMSSQINGSLTQVFYNSSKAACSNLVKGLAAEWASAIRVNALSPGYVNTDQTAHM-DKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI... 264
75 -82.9004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  29  9.RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMD------LAPRLAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAARIITIGSVNSFMA-EPEAAAYVAAKGGVAMLTRAMAVDLARHILVNMIAPGPVDVTGNNTGSEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSA... 260

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.