current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3cfw_A mol:protein length:164 L-selectin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVQVDPRLIDLast
1 -91.9003cfw_A mol:protein length:164 L-selectin  ali model  100  1WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVQVDPRLID 164
2 -84.8001g1q_A mol:protein length:162 P-SELECTIN  ali model follow..  63  1WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRDDDD... 161
3 -51.8001sl6_A mol:protein length:184 C-type lectin DC-SIGNR  ali model follow..  26  57WCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDQEGTWQWVDGSPLSPSFQRYWNSGEPNNS-GNEDCAEFS------GSGWNDNRCDVDNYWICKKPAACFRD...................................... 183
4 -51.5001k9i_A mol:protein length:156 mDC-SIGN1B type I isoform  ali model follow..  28  19.CYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLEGTWQWVDGSPLLPSFKQYWNRGEPNNV-GEEDCAEFS------GNGWNDDKCNLAKFWICKKSAASCSRDEEQ.................................. 142
5 -51.2002xr5_A mol:protein length:166 CD209 ANTIGEN  ali model follow..  27  22WCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDQEGTWQWVDGSPLLPSFKQYWNRGEPNNV-GEEDCAEFS------GNGWNDDKCNLAKFWICKKSAASCSRDEEQ.................................. 152
6 -51.1002xr6_A mol:protein length:170 CD209 ANTIGEN  ali model follow..  27  26WCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDQEGTWQWVDGSPLLPSFKQYWNRGEPNNV-GEEDCAEFS------GNGWNDDKCNLAKFWICKKSAASSSRDEEQ.................................. 156
7 -51.1003p7f_A mol:protein length:146 C-type lectin domain family 4 member K  ali model follow..  29  14.FYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTA--GGLIYWIGLTKMEGDWSWVDDTPNKVQSVRFWIPGEPNNAGNNEHCGNI---KAPSLQAWNDAPCDKTFLFICKRPYVPSEPSAWSHPQFE............................. 145
8 -51.1002b6b_D mol:protein length:175 CD209 antigen  ali model follow..  27  25WCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDQEGTWQWVDGSPLLPSFKQYWNRGEPNNV-GEEDCAEFS------GNGWNDDKCNLAKFWICKKSAASCSRDEEQ.................................. 155
9 -51.0001wk1_A mol:protein length:150 Hypothetical protein yk1067a12  ali model follow..  18  10.FLTVNDDILSMPQARNFCASAGGYLADDLGDDKNNFYSSIA--ANTQFWIGLFKSDGQFYWDRGQGLLNQPITYWANGEPSN-DPTRQCVYFDGRSGDKSKVWTTDTCATPRPFICQKHRYDSDH...................................... 136
10 -51.0003kqg_A mol:protein length:182 C-type lectin domain family 4 member K  ali model follow..  31  53WFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTA--GGLIYWIGLTKMEGDWSWVDDTPNKVQSARFWIPGEPNNAGNNEHCGNI---KAPSLQAWNDAPCDKTFLFICKRPYVPSEP...................................... 182
11 -50.7004n36_A mol:protein length:136 C-type lectin domain family 4 member K  ali model follow..  30  14.FYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTA--GGLIYWIGLTKMEGDWSWVDDTPNKVQSARFWIPGEPNDAGNNEHCGNI---KAPSLQAWNDAPCDITFLFICKRPYVPSEP...................................... 136
12 -50.5004ak8_A mol:protein length:155 C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K  ali model follow..  31  33.FYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQELLYKTA--GGLIYWIGLTKMEGDWSWVDDTPNKVQSARFWIPGEPNNAGNNEHCGNI---KAPSLQAWNDAPCDKTFLFICKRPYVPSEP...................................... 155
13 -50.3003c22_A mol:protein length:156 C-type lectin domain family 4 member K  ali model follow..  31  27WFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTA--GGLIYWIGLTKMEGDWSWVDDTPNKVQSARFWIPGEPNNAGNNEHCGNI---KAPSLQAWNDAPCDKTFLFICKRPYVPSEP...................................... 156
14 -49.9003wh2_A mol:protein length:147 C-type lectin domain family 4 member E  ali model follow..  26  19.CYFFSTDTKSWALSLKNCSAMGAHLVVINSQEEQEFLSYKKP-KMREFFIGLSDQEGQWQWVDGTP-LTKSLSFWDVGEPNNIATLEDCATMR-DSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKS.................................. 146
15 -49.8001byf_A mol:protein length:125 PROTEIN (POLYANDROCARPA LECTIN)  ali model follow..  18  4.EILFSDETMNYADAGTYCQSRGMALVSSAMRDSTMVKAAFTEVKGHDYWVGADNLQYNFLWNDGVS-LPTDSDLWSPNEPSNPQSWQLCVQIW----SKYNLLDDVGCGGARRVICEKELDD......................................... 125
16 -49.3002ggu_A mol:protein length:160 Pulmonary surfactant-associated protein D  ali model follow..  25  49.IFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDTEGKFTYPTGESL---VYSNWAPGEPNDDGGSEDCVEIF-----TNGKWNDRACGEKRLVVCE.............................................. 159
17 -49.0001dv8_A mol:protein length:128 ASIALOGLYCOPROTEIN RECEPTOR 1  ali model follow..  25  12.CYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHI--GPVNTWMGLHDQNGPWKWVDGTD-YETGFKNWRPEQPDDWGGGEDCAHFT-----DDGRWNDDVCQRPYRWVCETE............................................ 127
18 -48.9001b08_A mol:protein length:158 PROTEIN (LUNG SURFACTANT PROTEIN D)  ali model follow..  25  47.IFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDTEGKFTYPTGESL---VYSNWAPGEPNDDGGSEDCVEIF-----TNGKWNDRACGEKRLVVCE.............................................. 157
19 -48.9004kzv_A mol:protein length:134 C-type lectin mincle  ali model follow..  29  13.CYLFSPDTMSWRASLKNCSSMGAHLVVINTQEEQEFLYYTKP-RKKEFYIGLTDTEGQWQWVDGTP-FTKSLSFWDAGEPNNLVTVEDCATIR-DSSNPRQNWNDVPCFFNMFRVCEMPE........................................... 131
20 -48.6004m17_A mol:protein length:147 Pulmonary surfactant-associated protein D  ali model follow..  25  36.IFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDTEGKFTYPTGESL---VYSNWAPGEPNDAGGSEDCVEIF-----TNGKWNDVACGEKRLVVCE.............................................. 146
21 -48.5003zhg_A mol:protein length:158 CD209 ANTIGEN-LIKE PROTEIN B  ali model follow..  27  32WCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSK-AKGPTWMGLSDLEATWLWVDGSTLSSRFQKYWNRGEPNNI-GEEDCVEFAGDG------WNDSKCELKKFWICKKSATPCTE...................................... 157
22 -48.1004yli_A mol:protein length:155 Collectin-11  ali model follow..  24  38.IYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQGLARVFIGINDKEGAFVYSDHSP--MRTFNKWRSGEPNNAYDEEDCVEMV-----ASGGWNDVACHTTMYFMCEFDKEN......................................... 155
23 -48.0001pw9_A mol:protein length:177 Pulmonary surfactant-associated protein D  ali model follow..  25  66.IFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDTEGKFTYPTGESL---VYSNWAPGEPNDDGGSEDCVEIF-----TNGKWNDRACGEKRLVVCE.............................................. 176
24 -47.9005b1w_A mol:protein length:134 C-type lectin domain family 4 member A  ali model follow..  22  14.CYFISTESASWQDSEKDCARMEAHLLVINTQEEQDFIFQNLQ-EESAYFVGLSDPQRHWQWVDQTP-YNESSTFWHPREPSD--PNERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEMMK........................................... 131
25 -47.5002ox8_A mol:protein length:140 Scavenger receptor with C-type lectin type I  ali model follow..  27  16.CYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQM-VGRESHWIGLTDRENEWKWLDGTSP---DYKNWKAGQPDNWGPGEDCAGLI-----YAGQWNDFQCEDVNNFICEKDRETVLS...................................... 137
26 -47.5003wbp_A mol:protein length:153 C-type lectin domain family 4 member C  ali model follow..  28  31.CYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLK-RNSSYFLGLSDPRRHWQWVDQTP-YNENVTFWHSGEPNN--LDERCAIINFRSSEEWG-WNDIHCHVPQKSICKMKK........................................... 147
27 -47.0001kx0_A mol:protein length:149 MANNOSE-BINDING PROTEIN A  ali model follow..  23  39.FFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVA---KTSAFLGITDTEGQFMYVTGGRL---TYSNWKKDEPNDVGSGEDCVTIV-----DNGLWNDVSCQASHTAVCEFPA........................................... 149
28 -47.0002ox9_A mol:protein length:140 Collectin placenta 1  ali model follow..  27  16.CYYFSLEKEIFEDAKLFCEDKSSHLVFINSREEQQWIKKHT-VGRESHWIGLTDQESEWKWLDGSPV---DYKNWKAGQPDNWGPGEDCAGLI-----YAGQWNDFQCDEINNFICEKEREAVPS...................................... 137
29 -46.9001kmb_1 mol:protein length:149 MANNOSE-BINDING PROTEIN-A  ali model follow..  25  39.FFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVA---KTSAFLGITDTEGQFMYVTGGRL---TYSNWKKDEPNDHGSGEDCVTIV-----DNGLWNDISCQKKKTAVCEFPA........................................... 149
30 -46.8002vuv_A mol:protein length:129 CODAKINE  ali model follow..  28  13.CYIYQSAKASWASAQSSCQALGGILAEPDTACENEVLIHMCKENGDGPWLGGQKVGGAWQWSSSGAAF--DYLRWGPNEPNNSGGNEDCLHY------NWLSWNDLRCHYQASYLCQRAA........................................... 128
31 -46.6004dn8_A mol:protein length:156 Pulmonary surfactant-associated protein D  ali model follow..  25  42.IFKTGGFEKTFQDAQQVCTQAGGQMASPRSETENEALSQLVTAQNKAAFLSMTDTEGQFTYPTGEPL---VYANWAPGEPNNNGGAENCVEIF-----PNGKWNDKACGELRLVICE.............................................. 155
32 -46.6001buu_A mol:protein length:168 PROTEIN (MANNOSE-BINDING PROTEIN A)  ali model follow..  23  58.FFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVA---KTSAFLGITDTEGQFMYVTGGRL---TYSNWKKDEPNDHGSGEDCVTIV-----DNGLWNDISCQASHTAVCEFPA........................................... 168
33 -46.5004zes_A mol:protein length:147 C-type lectin domain family 4 member C  ali model follow..  28  28.CYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLK-RNSSYFLGLSDPRRHWQWVDQTP-YNENVTFWHSGEPNN--LDERCAIINFRSSEEWG-WNDIHCHVPQKSICKMKK........................................... 144
34 -46.5004wr9_A mol:protein length:148 Pulmonary surfactant-associated protein A  ali model follow..  23  38.VFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIDTEGDFHYLDGASV---SYTNWYPGEPRG-QGKEDCVEMY-----TDGTWNDRGCLQYRLAVCE.............................................. 147
35 -46.4003whd_A mol:protein length:156 C-type lectin domain family 4 member D  ali model follow..  24  29WCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLD-RRLSYFLGLRDAKGQWRWVDQTP-FNPRRVFWHKNEPDNSQG-ENCVVLVYN--QDKWAWNDVPCNFEASRICKIPGTTLN....................................... 156
36 -46.4001r13_A mol:protein length:148 Pulmonary surfactant-associated protein A  ali model follow..  22  38.VFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIETPGDFHYLDGASV---SYTNWYPGEPRG-QGKEKCVEMY-----TDGTWNDRGCLQYRLAVCE.............................................. 147
37 -46.3002py2_A mol:protein length:136 Antifreeze protein type II  ali model follow..  18  15.CFLFNPLQLHWADAQESCMKEGANLASIHSLEESTFVKELTSADLIPSWIGGTDVSTRWFWMDSTSM---DYADWCAAQPDTTLT-ECCIQMNVG---IGKCWNDTPCTHLHSSICAKP............................................ 128
38 -45.6001fif_A mol:protein length:154 MANNOSE-BINDING PROTEIN-A  ali model follow..  21  39.FFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVA---KTSAFLGITDTEGQFMYVTGGRL---TYSNWKKDQPDDWGGGEDCVHIV-----DNGLWNDDSCQRPYTAVCEFPA........................................... 154
39 -45.5001hup_A mol:protein length:141 MANNOSE-BINDING PROTEIN  ali model follow..  24  31.FFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLI---KEEAFLGITDTEGQFVDLTGNRL---TYTNWNEGEPNNAGSDEDCVLLL-----KNGQWNDVPCSTSHLAVCEFP............................................ 140
40 -45.4001bcj_1 mol:protein length:154 MANNOSE-BINDING PROTEIN-A  ali model follow..  20  39.FFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVA---KTVAFLGITDTEGQFMYVTGGRL---TYSNWKKDQPDDWGGGEDCVHIV-----DNGLWNDISCQASHTAVCEFPA........................................... 154
41 -45.3001afa_1 mol:protein length:154 MANNOSE-BINDING PROTEIN-A  ali model follow..  20  39.FFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVA---KTSAFLGITDTEGQFMYVTGGRL---TYSNWKKDQPDDWGGGEDCVTIV-----DNGLWNDISCQASHTAVCEFPA........................................... 154
42 -45.3001egg_A mol:protein length:147 MACROPHAGE MANNOSE RECEPTOR  ali model follow..  27  18.CFKLKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLIGSYHKLFWLGLTYPSEGFTWSDGSPV---SYENWAYGEPNNYQNVEYCGELKGD---PTMSWNDINCEHLNNWICQIQKGQTPK...................................... 145
43 -45.1001t8c_A mol:protein length:143 Low affinity immunoglobulin epsilon Fc recept  ali model follow..  30  19.CYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHA--SHTGSWIGLRNLKGEFIWVDGSHV---DYSNWAPGEPTSRSQGEDCVMMR-----GSGRWNDAFCDRKLAWVCDRLATCTPP...................................... 136
44 -45.0005FFR Entity 1(prereleased)  ali follow..  22  15.KHQILQTMGVLSLQGSXCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIETPGDFHYLDGASV---SYTNWYPGEPRG-QGKEKCVEMY-----TDGTWNDRGCLQYRLAVCE.............................................. 124
45 -44.9002h2r_A mol:protein length:175 Low affinity immunoglobulin epsilon Fc recept  ali model follow..  25  28.CYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKRA--SHTGSWIGLRNLKGEFIWVDGSHV---DYSNWAPGEPTSRSQSEDCVMM-----RGSGRWNDAFCDRKLAWVCDRLATCTPPASEGSAESDSRPDPDGRLPTPS................ 170
46 -44.9002ls8_A mol:protein length:156 C-type lectin domain family 4 member D  ali model follow..  23  14.CYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLD-RRLSYFLGLRDAKGQWRWVDQTP-FNPRRVFWHKNEPDNSQG-ENCVVLVYN--QDKWAWNDVPCNFEASRICKIPGTTLNAENLY.................................. 139
47 -44.3001tdq_B mol:protein length:130 Aggrecan core protein  ali model follow..  28  18.CYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNKN---AQDYQWIGLNDIEGDFRWSDGHSL---QFEKWRPNQPDNFATGEDCVVMIWH---ERGEWNDVPCNYQLPFTCKKG............................................ 130
48 -43.9002zib_A mol:protein length:133 Type II antifreeze protein  ali model follow..  21  15.CFYSEATAMTWDLAEANCVNKGGHLASIHSLEEQLYIKDIV---AGIVWIGGSAVAGAWSWTDGTPV---DYRTWCPTKPNDILS-DCCMQM---TAAVDKCWDDLPCPASHASICAKAA........................................... 126
49 -43.8004wqq_A mol:protein length:141 Lectin CEL-I, N-acetyl-D-galactosamine-specif  ali model follow..  26  15.CYRFFNTLTTWENAHHECVSYRSDLVSVHSAAEQAYVFNYWDSQAGQLWIGLYDNEGDFIWTDGSKV---GYTKWAGGEPNNHNNAEDYGQF---RHTEGGAWNDNSAAAQAKYMCKLT............................................ 139
50 -43.4001wmy_A mol:protein length:140 lectin CEL-I, N-acetyl-D-galactosamine-specif  ali model follow..  23  14.CYRFFNTLTTWENAHHECVSYRSDLVSVHSAAEQAYVFNYWDSQAGQLWIGLYDNEGDFIWTDGSKV---GYTKWAGGQPDNWNNAEDYGQFRH---TEGGAWNDNSAAAQAKYMCKLT............................................ 138
51 -43.2002afp_A mol:protein length:129 PROTEIN (SEA RAVEN TYPE II ANTIFREEZE PROTEIN  ali model follow..  19  18.CIYYETTAMTWALAETNCMKLGGHLASIHSQEEHSFIQTL---NAGVVWIGGSAQAGAWTWSDGTPM---NFRSWCSTKPDDVLA-ACCMQM---TAAADQCWDDLPCPASHKSVCAMT............................................ 128
52 -42.8003vyj_A mol:protein length:129 C-type lectin domain family 4, member a4  ali model follow..  25  14.CYFILNDSKSWNESEEKCSHMGAHLVVIHSQAEQDFITSNLN-TSAGYFIGLLDAQRQWRWIDQTP-YNKSATFWHKGEPNQ--DWERCVII--NHKTTGWGWNDIPCKDEHNSVCQVKK........................................... 129
53 -42.5001bv4_A mol:protein length:118 PROTEIN (MANNOSE-BINDING PROTEIN-C)  ali model follow..  24  8.YFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVA---KDVAFLGITDTENVFEDLTGNRV---RYTNWNEGEPNNVGSGENCVVLL-----TNGKWNDVPCSDSFLVVCEFS............................................ 117
54 -42.4001jzn_A mol:protein length:135 Galactose-specific lectin  ali model follow..  24  14.CYKIFNQLKTWEDAEMFCRKYGCHLASFHRYGESLEIAEYISDGQENVWIGLRDKDFSWEWTDRSCT---DYLTWDKNQPDHYQNKEFCVEL--VSLTGYRLWNDQVCESKDAFLCQCK............................................ 134
55 -42.2001htn_A mol:protein length:182 TETRANECTIN  ali model follow..  18  61.CFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSEAEIWLGLNDAEGTWVDMTGARIAYKNWETEITAQPDG-GKTENCAVL---SGAANGKWFDKRCRDQLPYICQFGI........................................... 181
56 -41.5003als_A mol:protein length:157 Lectin CEL-IV, C-type  ali model follow..  19  9WCFRLFHNHLNFDNAENACRQFGGHLASIHSAESQAFLTELVKTSAPQVYIGMKVTNSDQTWTDGSSV---DYDGWVSGEPNNGPNSRGAIAA---GDYSRGFWADVYSNNNFKYICQLPCVHYTL...................................... 156
57 -40.8002bpd_A mol:protein length:142 DECTIN-1  ali model follow..  20  15WCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINFWIGLSRSEGPWFWEDGSA-FFPNSFQVRNAVPQES-LLHNCVWI------HGSEVYNQICNTSSYSICEKE............................................ 135
58 -40.7002bpe_A mol:protein length:140 DECTIN-1  ali model follow..  20  12WCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRNAFWIGLSRSEGPWFWEDGSA-FFPNSFQVRNAVPQES-LLHNCVWI------HGSEVYNQICNTSSYSICEKE............................................ 132
59 -40.0003l9j_C mol:protein length:134 TNFalpha  ali model follow..  19  14.CFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSEAEIWLGLNKSRYFWVDMTGTRIAYKNWEHSSDAQPDP-SNWENCAVL---SGAANGKWFGKRCRDQLPYICQFG............................................ 133
60 -39.8001lit_A mol:protein length:144 LITHOSTATHINE  ali model follow..  22  25.CYYFNEDRETWVDADLYCQNNSGNLVSVLTQAEGAFVASLIKEDDFNVWIGLHDKNRRWHWSSGSLV---SYKSWGIGAPSSV-NPGYCVSL--TSSTGFQKWKDVPCEDKFSFVCKFKN........................................... 144
61 -38.9004uww_A mol:protein length:132 STRUTHIOCALCIN-1  ali model follow..  19  14.CYGYFRYELPWKRAEAWCRSAGAHLASIHTSEEHRAIAKFISEEEEDVWIGLFRWNSVWAWIDGSKK---HYSAL---DDDDYPKGKHCAVL--DESSGFLSWDNDSCGERNAFICKCTA........................................... 132
62 -38.8001h8u_A mol:protein length:117 EOSINOPHIL GRANULE MAJOR BASIC PROTEIN 1  ali model follow..  19  3.RYLLVRSLQTFSQAWFTCRRYRGNLVSIHNFNINYRIQCSVSANQGQVWIGGRGRCRRFQWVDGSR----NFAYWAAHQPWS--RGGHCVALC----TRGGYWRRAHCLRRLPFICS.............................................. 116
63 -38.8001ypo_A mol:protein length:132 oxidised low density lipoprotein (lectin-like  ali model follow..  16  8WCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRSYPWLWEDGSPLMPHLFRV--RGAVSQTYPSGTCAYI------QRGAVYAENCILAAFSICQKKANLRA....................................... 132
64 -38.3001gz2_A mol:protein length:142 OVOCLEIDIN-17  ali model follow..  20  16.CLGFFSRELSWSRAESFCRRPGSHLAAVRSAAELRLLAELLNAADGRVWIGLHRGSRSWRWSDGTAP---RFASWHRTAKAR--RGGRCAAL--RDEEAFTSWAARPCTERNAFVCKAAA........................................... 142
65 -38.1003vlg_A mol:protein length:145 Oxidized low-density lipoprotein receptor 1  ali model follow..  16  20WCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRSYPWLWEDGSPLMPHLFRV--RGAVSQTYPSGTCAYI------QRGAVYAENCILAAFSICQKKAN.......................................... 141
66 -37.4004iop_B mol:protein length:158 Killer cell lectin-like receptor subfamily F  ali model follow..  21  24WCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLK-PGHFGWIGLYVTGNLWMWIDEHFL---VPELFSVIGPTD---DRSCAVI------TGNWVYSEDCSSTFKGICQRDA........................................... 139
67 -37.4002m94_A mol:protein length:139 Killer cell lectin-like receptor subfamily B  ali model follow..  19  10WCFHVSQVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRLPDMNWKWINGSTLNSDVLKITGDTE------NDSCAAI------SGDKVTFESCNSDNRWICQKELYHETLSNYVGY................................ 137
68 -37.3001uv0_A mol:protein length:149 PANCREATITIS-ASSOCIATED PROTEIN 1  ali model follow..  21  25.CYALFLSPKSWTDADLACQKRSGNLVSVLSGAEGSFVSSLVKSSYSYVWIGLHDPGEGWEWSSSDVM---NYFAWERNPSTI-SSPGHCASL--SRSTAFLRWKDYNCNVRLPYVCKFT............................................ 148
69 -36.7003vpp_A mol:protein length:132 C-type lectin domain family 9 member A  ali model follow..  16  8WCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKGSYDYWVGLSQDSGRWLWQDGSSP---SPGLLPAERSQS--ANQVCGYV------KSNSLLSSNCDTWKYFICEKYALRSS....................................... 131
70 -36.6003wsr_A mol:protein length:128 C-type lectin domain family 1 member B  ali model follow..  17  13WCYGFFRHNLTWEESKQYCTDMNATLLKIDNRNIVEYIKAR---THLIRWVGLSRSNEVWKWEDGSVI---SENMFEFLEDGK--GNMNCAYF------HNGKMHPTFCENKHYLMCERKAG.......................................... 128
71 -36.5002kv3_A mol:protein length:131 Regenerating islet-derived protein 4  ali model follow..  20  14.CYGYFRKLRNWSDAELECQSYGAHLASILSLKEASTIAEYISGRSQSIWIGLHDKRQQWQWIDGAMY---LYRSWSGKSMGG---NKHCAEM--SSNNNFLTWSSNECNKRQHFLCKYR............................................ 130
72 -36.4003c8j_A mol:protein length:203 Natural killer cell receptor Ly49C  ali model follow..  16  84WCYYFIMNKTTWSGCKANCQHYGVPILKIEDEDELKFLQRHV--IPGNYWIGLSKKKKEWAWIDNGPSKLDMKIK------KMNFKSRGCVFL------SKARIEDIDCNIPYYCICGKKLDKFPD...................................... 203
73 -36.4001fvu_B mol:protein length:125 BOTROCETIN BETA CHAIN  ali model follow..  19  13.CYRFFKEWMHWDDAEEFCTEQGAHLVSFQSKEEADFVRSLTSEKGDVVWIGLSDNKCRFEWTDGMEF---DYDDYYLIAE------YECVASK----PTNNKWWIIPCTRFKNFVCEFQA........................................... 125
74 -36.1002yhf_A mol:protein length:118 C-TYPE LECTIN DOMAIN FAMILY 5 MEMBER A  ali model follow..  16  13.CFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDIT--DAEKYFIGLIYHEKRWRWINNSVFNGNVT---------NQNQNFNCATI-----GLTKTFDAASCDISYRRICEKNA........................................... 118
75 -35.7001iod_A mol:protein length:129 COAGULATION FACTOR X BINDING PROTEIN  ali model follow..  20  13.CYKVFKQSKTWADAESFCTKQGGHLVSIESSGEADFVGQLIAQKKIHVWIGLRAKQCSIEWSDGSSI---SYENWIEEESKK------CLGVHIE--TGFHKWENFYCEQQDPFVCEA............................................. 129

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.