current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3bbd_A mol:protein length:205 Ribosome biogenesis protein NEP1-like, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MTYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLSFLast
1 -108.0003bbd_A mol:protein length:205 Ribosome biogenesis protein NEP1-like  ali model  100  1MTYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLSF 205
2 -85.1002v3j_A mol:protein length:258 ESSENTIAL FOR MITOTIC GROWTH 1  ali model follow..  26  40.RMIVVLAMASLETHKIS----SNGPGGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLLKVIKNPIKCRKVTLSFDAPVIRVQDYIDESICVFVGAMARGKDNFADE---YVDEKVGLSNYPLSASVACSKFCHGAE. 246
3 -84.0003o7b_A mol:protein length:244 Ribosome biogenesis Nep1 RNA methyltransferas  ali model follow..  32  20MGSAFVFLEASLELIPQKIRGHIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRD---FEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITLIEFKDVGLRDIVR--GRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYE. 230
4 -83.0005fai_A mol:protein length:232 Ribosomal RNA small subunit methyltransferase  ali model follow..  26  30.RLIVVLEGASLETVKVG----------KTYELLNCDKHKSILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQLLHKLSVRAADGPQKLLKVIKNPVGCMKVGTSFSIPVVSDVRELSDPIVFVVGAFAHGKVSVEY-----TEKMVSISNYPLSAALTCAKLTTAFE. 226
5 -11.0002qwv_A mol:protein length:208 UPF0217 protein VC_A1059  ali model follow..  12  9............................RSFILRARSAPTDSQRLLDEIGGKCHTEILAHCMMNFTAQSHREDVVIHLVLESTRDYSRTIEISDVGGFHEAALIALLVKALDRVVQPGLTVRTISFEALLGELAEHSLYMMDKKGDSIRDIKIGPNPCFILT--DHIPMPKKSGNSMKRVEKISLGPKMLFASQCVTLIHNEID. 202
6 -10.1002qmm_A mol:protein length:197 UPF0217 protein AF_1056  ali model follow..  17  1.........................SNAVRGFLIVGNKAFTQPFSLNDLPGAGRMDVLCRCTSQALFISHGIRRDVEVYLLLLGPILIKGDEVRRMSPDERNVAGHIKKALAKKVHSGVYVSRKGLEELIEELSEKSIIYLKEDGVDISNAQLPPNPLFVIGDHEGLTEEQEKVVERYAALKLSLSPLSLLAEQCVVIAHHHLD. 193
7 -7.5303hpb_A mol:protein length:161 Snx5 protein  ali model follow..  14  12.............................................................LQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLTETTDYA........................................................................................ 67
8 -7.3501oyp_A mol:protein length:245 Ribonuclease PH  ali model follow..  12  37.....VICNASVE-VPPFLRGGGKGWITAEYSMLPRATNQRTIRESSKGKISGRT-LIGRALRAVVD--LEKLGERTIWIDCD---VIQADGGTRTASITGAFLAMIGKLIKAGTIKTNPITDFLAAISVGIDKEQGILLDLNYEEDSSAEVDMNVIMTGSGRFVQGTGEEATFSREDLNGLLGLAEKGIQELIDKQK....... 234
9 -7.3201oys_A mol:protein length:245 Ribonuclease PH  ali model follow..  12  37.....VICNASVE-VPPFLRGGGKGWITAEYSMLPQATNQQTIQESSKGKISGRT-LIGRALRAVVD--LEKLGERTIWIDCD---VIQADGGTRTASITGAFLAMIGKLIKAGTIKTNPITDFLAAISVGIDKEQGILLDLNYEEDSSAEVDMNVIMTGSGRFVQGTGEEATFSREDLNGLLGLAEKGIQELIDKQK....... 234
10 -7.0003dd6_A mol:protein length:255 Ribonuclease PH  ali model follow..  10  41.....VICSATIE-VPPFMRGEGKGWVTAEYAMIPRATEQRTIRESSKGKVTGRT-LIGRALRAVVD--LEALGERTVWIDCD---VIQADGGTRTASITGAYVAMFEKLLQAEKVSKIPVKDYLAATSVGIVEEQGVVLDLNYAEDSKADVDMNVIMTGKGQFVQGTGEEATFSRAQLNELLDAAEQGIFQLIDIQK....... 238

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.