current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3b3q_E mol:protein length:197 NRXN1 protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst HSAFAADPGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPLast
1 -86.0003b3q_E mol:protein length:197 NRXN1 protein  ali model  100  1HSAFAADPGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP 190
2 -76.0003vkf_C mol:protein length:181 Neurexin-1-beta  ali model follow..  99  2..........SGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEV. 180
3 -75.7003bod_A mol:protein length:178 Neurexin-1-alpha  ali model follow..  97  1........APLGSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRL..... 177
4 -74.6002r1b_A mol:protein length:220 Neurexin-1-beta  ali model follow..  88  1..GSSLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGERLAIARQRIPYRLGRVVDGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP 218
5 -73.8003bop_A mol:protein length:175 beta-Neurexin 2D4  ali model follow..  78  1...........ATTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRL..... 174
6 -73.4003biw_E mol:protein length:243 Neurexin-1-beta  ali model follow..  95  43PASLRGGHA--GTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP 230
7 -70.9003mw4_A mol:protein length:178 Neurexin-2-beta  ali model follow..  70  2.........PGSATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGANATLQVDNWPVNEHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRL..... 177
8 -70.8002r1d_A mol:protein length:226 Neurexin-1-beta  ali model follow..  94  26YRSPASLRGGHATTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP 216
9 -68.7003mw2_A mol:protein length:207 Neurexin-1-alpha  ali model follow..  90  4............STYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGERLAIARQRIPYRLGRVVDGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRL..... 206
10 -68.3003mw3_A mol:protein length:208 Neurexin-2-beta  ali model follow..  70  2.........PGSTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGERLAIARQRIPYRLGRVVDGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRL..... 207
11 -61.8003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  92 1054.TSFSGPLCNDPGTTYIFKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP 1243
12 -61.4003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  93  213.TSFSGPLCNDPGTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVS 402
13 -58.0003v64_A mol:protein length:191 Low-density lipoprotein receptor-related prot  ali model follow..  14  1...........ALETLAFDGRTYIEYLNAVIESELTQSNHFELSLRTEATQGLVLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLRS-TVKVNTNRWLRIRAHREHREGSLQVGNEAPVTGS-SPLGATQLDTDGALWLGGLQKGTGFVGCLRDVVVGHRQ-LHLLEDAVTKPELR-----PCPTP 191
14 -56.9001q56_A mol:protein length:195 Agrin  ali model follow..  14  1..GSEKVIIEKAAGAIAFDGRTYMEYHNAVKSEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLRS-TVPINTNHWTHIKAYRVQREGSLQVGNEAPITGS-SPLGATQLDTDGALWLGGMERSTGFIGCIRDVIVDRQEL........................ 177
15 -56.2001pz7_A mol:protein length:204 Agrin  ali model follow..  14  18.DGRTYMEYHNAVTKSP-DALDYPAEP----SEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVL-RSTVPINTNHWTHIKAYRVQREGSLQVGNEAPITGS-SPLGATQLDTDGALWLGGMERSTGFIGCIRDVIVDRQE-LHLVEDALNNPTI........... 198
16 -56.1002h0b_A mol:protein length:184 Neurexin-1-alpha  ali model follow..  22  3..........KEEYIATFKGSEYFCYDLSQ-NPIQSSSDEITLSFKTLQRNGLMLHTGKS---ADYVNLALKNGAVSLVINLGSGAFEALPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGY-TQEDYTMLGSDDFFYVGGSPSSNNFMGCLKEVVYKNNDVSRLAKQGDPKMKIHG......... 183
17 -55.7002r16_A mol:protein length:182 Neurexin-1-alpha  ali model follow..  21  3..........REATVLSYDGSMFMKIQLP--VVMHTEAEDVSLRFRSQRAYGILMATTSRDS-ADTLRLELDAGRVKLTVNLGKGPETL-FAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRL--EFHNIETGIITEPSNFIGHLQSLTFNGMAYIDLCKNGDID.............. 169
18 -55.6001pz8_A mol:protein length:201 Agrin  ali model follow..  14  1....EKVIIEKAAGAIAFDGRTYMEYHNEIPAEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLRS-TVPINTNHWTHIKAYRVQREGSLQVGNEAPITGS-SPLGATQLDTDGALWLGGMERSTGFIGCIRDVIVDRQE-LHLVEDALNNPTI........... 195
19 -53.2001qu0_A mol:protein length:191 LAMININ ALPHA2 CHAIN  ali model follow..  14  1.....APLAANAESGTYFDGTGFAKAV---GGFKVGLDLLVEFEFRTTRPTGVLLGISSQK--MDGMGIEMIDEKLMFHVDNGAGRFTAIYDPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSAS-TSADTNDPVFVGGFPGGIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSC... 188
20 -52.7003pve_A mol:protein length:189 Agrin, Agrin protein  ali model follow..  17  1....SLENAGSRPFLADFNGFSYLELKLHTFERDLGEKMALEMVFLARGPSGLLLYNGQTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRS-KEPIALGTWVRVFLERNGRKGALQVGDGPRVLG-ESPVPHTMLNLKEPLYVGGAPDASGFDGAIQLVSLRGHQ-LLTQEHVLRAVDV........... 184
21 -52.7003sh4_A mol:protein length:195 LG3 peptide  ali model follow..  15  5............QYGAYFHDDGFLAFPHVFSRSLPEVPETIELEVRTSTASGLLLWQGVEVQGKDFISLGLQDGHLVFRYQLGSGEARLVS-EDPINDGEWHRVTALREGRRGSIQVDGEELVSG-RSPGPNVAVNAKGSVYIGGAPDSSGITGCVKNLVLHSARP........................ 170
22 -48.4001d2s_A mol:protein length:170 SEX HORMONE-BINDING GLOBULIN  ali model follow..  15  13..................EPIAVMTFDLTK-----ITKTSSSFEVRTWDPEGVIFYGDTNPK-DDWFMLGLRDGRPEIQLHNHWAQLTV-GAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVS-----GHPIMRIALGGLLFVPALDGCLRRDSWLD-KQAEISASAPTSL............. 167
23 -47.8001f5f_A mol:protein length:205 SEX HORMONE-BINDING GLOBULIN  ali model follow..  16  25..................EPIAVMTFDLTK-----ITKTSSSFEVRTWDPEGVIFYGDTNPK-DDWFMLGLRDGRPEIQLHNHWAQLTV-GAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRRQVSGPLTSKRHPIMRIALGGLLFPPALDGCLRRDSWLDKQA........................ 175
24 -42.6002jd4_A mol:protein length:383 LAMININ SUBUNIT ALPHA-1  ali model follow..  15  17........YVAGAHQFGLSQNSHLVLPLQQSD--VRKRLQVQLSIRTFASSGLIYYVAHQNQ-MDYATLQLQEGRLHFMFDLGKGRTKV-SHPALLSDGKWHTVKTEYIKRKAFMTVDGQESPS-VTVVGKATTLDVERKLYLGGLPSHHSIPACIGEIMVNGQQL........................ 179
25 -42.4001h30_A mol:protein length:422 GROWTH-ARREST-SPECIFIC PROTEIN  ali model follow..  14  43...............RMFSGTPVIRLRF---KRLQPTRLVAEFDFRTFDPEGILLFAGGHQD-STWIVLALRAGRLELQLRYNGVGRVT-SSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDQPERGLYHLNLTVGGIPFHPRLDGCMRSWNWLNGEDTTIQETVKVN.............. 209
26 -41.3001dyk_A mol:protein length:394 LAMININ ALPHA 2 CHAIN  ali model follow..  15  208.........ANAESGTYFDGTGFAKAV---GGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKM--DGMGIEMIDEKLMFHVDNGAGRFTAIEIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQ-SPNSASTSADTNDPVFVGGFPGGIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSC... 391
27 -41.0002wjs_A mol:protein length:608 LAMININ SUBUNIT ALPHA-2  ali model follow..  17  13...............VSSGGDCVRTYR---PEIKKGSYNNIVVHVKTAVADNLLFYLGSAKF-IDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIEASRTGRNGSISVRALDGPKASMVPSTYHSVDANAMLFVGGLTGKITFTGCMGETYFDNKPI........................ 178
28 -24.7001za4_A mol:protein length:251 Thrombospondin 1  ali model follow..  13  72....................................KGFLLLASLRMKKTRGTLLALERKDHSGQVFSVVSNAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDARLRIAKGGVNDNFQGVLQNVRF............................. 203
29 -22.6002v73_A mol:protein length:191 PUTATIVE EXO-ALPHA-SIALIDASE  ali model follow..  13  17.............NLKITKEEERVNITGDLEKFSSLEEGTIVTRFNMNDTSQSLIGLSDGNKANNYFSLYVSGGKVGYELR-GNGDFNVHHSADVTFNRGINTLALKEKGIGAKIFLNGSLVKTVSDPNIKFLNAINLNSGFIGKTDRANGFRGNIDFMNISDNYLLRKTGETK................ 191
30 -20.5004c1w_A mol:protein length:188 NEURAMINIDASE  ali model follow..  12  6.........EKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGKNNYNDAPLKVKPGQWNSVTFTVEKGRVRLYVNGVLSRTSLRSGNFIKDMPDVTHVQIGATKRANNSNLQIRNLTVTPEEVQKRS.................... 188
31 -17.2004qvs_A mol:protein length:227 S-layer domain-containing protein  ali model follow..  16  48.............SVSLDGVDDYVALPDGIAGTFYNFTIAFWVRLDTIGEQPIFDFFDSGSNNKYMRLTAESDGKIKFAMT-GYYGEKTITSGSALTEGVWKHVAVTLSGDTGTLYINGENVGENNLSLRPLTFLGETSKGYIGKSHQTDSLHGMIDDFRIFDRAL........................ 211
32 -15.9004kbb_A mol:protein length:459 Botulinum neurotoxin type B  ali model follow..  63...............LTSSANSKIRVTQNQNIIFNSVFLDFSVSFKYKNDGIQNYIHNEYTIINC-WKISIRGNRIIWTLIDINGKEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKD--IREVIANGEIIFKDGDIDRTQFIWMKYFSISQSNIEERYKIQSYS.............. 243
33 -15.3003flp_A mol:protein length:217 SAP-like pentraxin  ali model follow..  13  15..................QNPKFPHLR-FMQTLPAVRQLTVCQRIKPFHRNTGYIFSCATSNQDNQFITSMSDGTLNLGLQVNASSNKYISCPIEIELGQWYHVCHVGVDGRMAVYANGSPCGTMEISAGGTVVIGQEQDKIGGGFEEQESWSGELSDLQVWDEALTTSTVASCNGIRPRGNV....... 193
34 -15.0003fuq_A mol:protein length:417 BoNT/F (Neurotoxin type F)  ali model follow..  10  44...........NQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNYTQMISISDYINKWIFVTITNNRGNSRIYINGNLIDEKSISN--LGDIHVSDNILFKIVGCNDTRYVGIRYFKVGKTEIETLYSDEPDPSIL........... 229
35 -15.0003pme_A mol:protein length:420 Type C neurotoxin  ali model follow..  14  42.............DFKLSSSGDKIIVNLNNNILYSAIYENSSVSFKDLTNSHNEYTIINSIKQNSGWKLCIRNGNIEWILQDINRKDYSESLSHTGYTNKWFFVTITNNIGYMKLYING--ELKQSERIEDLDEVKLDKTIVFGDENIDENQMLWIRDFNIFSKELSN...................... 207
36 -14.9003obr_A mol:protein length:434 Botulinum neurotoxin type D  ali model follow..  14  49.............DFKLSSSGDKIIVNLNNNILYSAIYENSSVSFKDLTNSHNEYTIINSIEQNSGWKLCIRNGNIEWILQDVNRKYKSESLSHTGYTNKWFFVTITNNIGYMKLYING--ELKQSQKIEDLDEVKLDKTIVFGIDENDENQMLWIRDFNIFSKELSN...................... 214
37 -14.5003azv_A mol:protein length:443 D/C mosaic neurotoxin  ali model follow..  10  44NVQLNPIFPFDFKLGSSGDDRGKVIVTQNENIVYNAMYESFSISFNKWVSNLPGYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQYDISKNAAGYNKWFFVTITTNMGNMMIYINGKLIDTIKVKE--LTGINFSKTITFQMNKISDNINMWIRDFYIDDKDINILFNSLQYT.............. 241
38 -13.8004isq_A mol:protein length:431 Neurotoxin  ali model follow..  10  35NVQLNPIFPFDFKLGSSGDDRGKVIVTQNENIVYNAMYESFSISFNKWVSNLPGYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQYDISKNAAGYNKWFFVTITTNMGNMMIYINGKLIDTIKVKE--LTGINFSKTITFQMNKISDNINMWIRDFYIDDKDINILFNSLQYT.............. 232
39 -13.6001d0h_A mol:protein length:469 PROTEIN (TETANUS TOXIN HC)  ali model follow..  90..................................MFNNFTVSFWLRVPKVSAISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRLPDKFNAYLANKWVFITITNDRSSANLYINGVLMGSAEITG--LGAIREDNNITLKDRCNNNNQYVSIDKFRINPKEIEKLYTSYLSI.............. 255
40 -13.6002vu9_A mol:protein length:444 BOTULINUM NEUROTOXIN A HEAVY CHAIN  ali model follow..  44KVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN--YTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKYSQMINISDYINRWIFVTITNNRNNSKIYINGRLIDQKPISN--LGNIHASNNIMFKDGCRDTHRYIWIKYFNLNEKEIKDLYDNQSN............... 234
41 -13.6002vxr_A mol:protein length:482 BOTULINUM NEUROTOXIN TYPE G  ali model follow..  12  88..................SENSNITAHQSKFVVYDSMFDNFSINFPKYNNNDIQTYLQNCIKNDSGWKVSIKGNRIIWTLIDVNAKEYSIKDNISDYINKWFSITITNDRGNANIYING--SLKKSEKILNLDRINSSNDIDFKL--TDTTKFVWIKDFNIFGREL........................ 251
42 -13.5003r4s_A mol:protein length:443 Botulinum neurotoxin type C1  ali model follow..  12  38DVQLNPIFPFDFKLGSSGEDRGKVIVTQNENIVYNSMYESFSISFNKWVSNLPGYTIIDSVKNNSGWSIGIISNFLVFTLKQNEDSESYDISNNAPGYNKWFFVTVTNNMGNMKIYINGKLIDTIKVKE--LTGINFSKTITFEITSDSDNINMWIRDFYIFAKEL........................ 220
43 -13.4004jra_A mol:protein length:443 Botulinum neurotoxin type A  ali model follow..  44KVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN--YTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKYSQMINISDYINRWIFVTITNNRNNSKIYINGRLIDQKPISN--LGNIHASNNIMFKDGCRDTHRYIWIKYFNLFDKEL........................ 220
44 -13.2001fv2_A mol:protein length:472 TETANUS TOXIN HEAVY CHAIN  ali model follow..  97..................................MFNNFTVSFWLRVPKVSAISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRLPDKFNAYLANKWVFITITNDLSSANLYINGVLMGSAEITG--LGAIREDNNITLKDRCNNNNQYVSIDKFRINPKEIEKLYTSYLSI.............. 262
45 -13.2004pbp_A mol:protein length:210 C-reactive protein  ali model follow..  10  8..........SGKVLQFKTATDNSYVKLYPEKPLSLSAFTLCMRVATELPLD-ILFAYYTPDVDELNVWRERDGRVSLYIQ---SSKDAAFFRLPPLSTLQTHLCVASATGLTAFWMDGRRSLHQVYRKGYTVVLGQDPDSYVGSFDVDQSFVGEIANLQM............................. 165
46 -13.2004b1m_A mol:protein length:185 LEVANASE  ali model follow..  49...............................SSASGSDFTYESDITIKDGNALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRL------------VIDAHDSVFSEGQ----GLNVWDATAVFQNVTK........................ 173
47 -13.0004azz_A mol:protein length:172 LEVANASE  ali model follow..  38...............................SSASGSDFTYESDITIKDGNALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRL------------VIDAHDSVFSEGQ----GLNVWDATAVFQNVTKESL..................... 165
48 -12.7002uur_A mol:protein length:245 COLLAGEN ALPHA-1(IX) CHAIN  ali model follow..  16  86....................................EEYSFLTTFRTLKKNWNIWQIQDSSGKEQ-VGIKINGQTQSVVFSYGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLI............................. 217
49 -12.6001gyk_A mol:protein length:204 SERUM AMYLOID P-COMPONENT  ali model follow..  10  5..........SGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRYSLFSYNTQGRDNELLVYKERVGEYSLYIG-----RHKVTSKVIEKFPAPVHICVSWESSSAEFWINGTPLVKKGLRQGYKIVLGQEQDSYGGKFDRSQSFVGEIGDLYM............................. 159
50 -11.9001b09_A mol:protein length:206 PROTEIN (C-REACTIVE PROTEIN)  ali model follow..  5..........SRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTETRGYSIFSYATKRQDNEILIFWSKDIGYSFTVG-----GSEILFEVPEVTVAPVHICTSSASGIVEFWVDGKPRVRKSLKKGYSIILGQEQDSFGGNFEGSQSLVGDIGNVNM............................. 161
51 -10.7004yz1_A mol:protein length:677 Putative neuraminidase  ali model follow..  12  3SSGLEVLFQGPNTPVLEKNNGGGENVTKELKDKFTSGDFTVVIKYNQSSEKGLLFGISNSKPQNSYVDVFLRDGELGMEARDTSSNKNNLVSGKYKQEAVTNTVAVDSVKKTYSLYANGTKVVEKKVDNFLIKDIKGIDYYMLGGVKRAGGFNGTLENIKFFNSALDEETVKKMTTNAVTGHL....... 207
52 -10.6003v0a_B mol:protein length:1196 NTNH  ali model follow..  879.............ALYLNGSNQSISFSNDFFENGLTNSFSIYFWLRNLGKDTIKSKLIGSKEDNCGWEIYFQDTGLVFNMIDSNGNEKNIYLSD-VSNNSWHYITISRLKEQLLIFIDD--NLVANESIKEILNIYSSNIISLLS----ENNPSYIEGLTILNKPT........................ 1026
53 -10.3001sli_A mol:protein length:679 INTRAMOLECULAR TRANS-SIALIDASE  ali model follow..  8.........EKNNVDIAEGQGYSLDQEAGAKYVKAMTQGTIILSYKSTSENGILFSVGNSTAQDRHFHIYINSGGIGIELRNTDGDRPASVRALYKGERVFNTVALDAANKQCRLFANGELLATLDKDAFKISDITGVDNVTLGGTKRQGKFGGTIGDIKVYSNALSDEELIQATGVTTYGE........ 198
54 -9.6003zyp_A mol:protein length:218 CIP1  ali model follow..  33TVAHSGSNSMKVVGGPNGYCGHIFFGTTQVPTGDVYVRAWIRLQTALGSNHVTFIIMPDTAQGGKHLRIGGQSQVLDYNRTLPDLSPNGIASTVTLPTGAFQCFEYHGTDGTIETWLNGSLIPGMTVGPGVDNPNDAVNTVWFDDISIASTRVGC................................... 217
55 -9.0603ffz_A mol:protein length:1252 Botulinum neurotoxin type E  ali model follow..  888.............FGIYNDKLSEVNISQNDYIIYDNKYKNFSISFRIPNYDN---IINCMRDNNSGWKVSLNHNEIIWTLQDNAGINQGNANGISDYINKWIFVTITNDRGDSKLYING--NLIDQKSILNLGNIHVSDNILFKIVNCSYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNI....... 1071

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.