current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3asi_A mol:protein length:410 Neurexin-1-alpha, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst RNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVSRLENLYFQLast
1 -124.0003asi_A mol:protein length:410 Neurexin-1-alpha  ali model  100  1RNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVSRLENLYFQ 410
2 -96.1003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  99  842RNIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP........ 1243
3 -68.2003biw_E mol:protein length:243 Neurexin-1-beta  ali model follow..  81  10..................................................................................................................................................................................GGILEASSLGAHHIHHFHGSSKHHSVPIAIYRSPASLRGGHAG---TTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMT.... 234
4 -68.1002r1d_A mol:protein length:226 Neurexin-1-beta  ali model follow..  80  1............................................................................................................................................................................................GSSLGAHHIHHFHGSSHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTEST 224
5 -64.9001dyk_A mol:protein length:394 LAMININ ALPHA 2 CHAIN  ali model follow..  18  39.........GLSRNSHIAIADTKVKNRLTIELEVRTEAESGLLFYARINHADFATVQLRNGFPYFSYDLGSGDTSTM--IPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILYVGGLPINY--TTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPT------------------------------------------SSFHVGTCFANAESGTYFDGTGFAKAV---GGFKVGLDLLVEFEFRTTRPTGVLLGVSSQK--MDGMGIEMIDEKLMFHVDNGAGRFTAIYIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSAS-TSADTNDPVFVGGFPGGIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT........ 394
6 -61.4003b3q_E mol:protein length:197 NRXN1 protein  ali model follow..  93  2....................................................................................................................................................................................................................SAFAADPGHAGTT-YIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVP........ 190
7 -61.1002jd4_A mol:protein length:383 LAMININ SUBUNIT ALPHA-1  ali model follow..  19  26..........LSQNSHLVLQQSDVRKRLQVQLSIRTFASSGLIYYAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVS--HPALLSDGKWHTVKTEYIKRKAFMTVDGQESSVTVVGKATTLDVERKLYLGGLPSHY--RARNIGTITHSIPACIGEIMVNGQQLDKDRPLSASAVD------------------------------------------RCYVVAQEGTFFEGSGYAALVK--EGYKVRLDLQITLEFRTTSKNGVLLGISSAK--VDAIGLEIVDGKVLFHVNNGAGRITATYAARALCDGKWHTLQAHKSKHRIVLTVDGNSVRAESPHTHS-TSADTNDPIYVGGYPAHASFRGCVRNLRLSRGSQVQSLDLSRA-FDLQGVFPHSCPGPE....... 382
8 -58.0003vkf_C mol:protein length:181 Neurexin-1-beta  ali model follow..  99  2..............................................................................................................................................................................................................................SGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVS........ 181
9 -57.5003bod_A mol:protein length:178 Neurexin-1-alpha  ali model follow..  97  1...........................................................................................................................................................................................................................APLGST-YIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRL............. 177
10 -56.7002r1b_A mol:protein length:220 Neurexin-1-beta  ali model follow..  83  1.....................................................................................................................................................................................................................GSSLR-GGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGERLAIARQRIPYRLGRVVDGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEV----PSS.. 220
11 -56.7001h30_A mol:protein length:422 GROWTH-ARREST-SPECIFIC PROTEIN  ali model follow..  16  43........RMFSGTPVIRLRKRLQPTRLVAEFDFRTFDPEGILLFAGGQDSTWIVLALRAGRLELQLRYNGVGRVTS--SGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQLYHLNLTVGGIPFHEK---DLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTR-----------------------------------------MQCFSVTERGSFYPGSGFAFYSLDDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLERHLRSPVLTFAGGLPDTAFYRGCMT-LEVNRRLLLDEAAYKHSDITAHSCVEPAAA.......... 422
12 -56.6003bop_A mol:protein length:175 beta-Neurexin 2D4  ali model follow..  78  1...............................................................................................................................................................................................................................ATTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRL............. 174
13 -55.1003mw4_A mol:protein length:178 Neurexin-2-beta  ali model follow..  70  2.............................................................................................................................................................................................................................PGSATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGANATLQVDNWPVNEHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRL............. 177
14 -54.9002wjs_A mol:protein length:608 LAMININ SUBUNIT ALPHA-2  ali model follow..  14  6ANSIKVSVSSGGDCVRTYRPEIKKGSYNNIVVHVKTAVADNLLFYGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVE-YPDLTIDDSYWYRIEASRTGRNGSISVRALDGPKASMVPSTDVDANAMLFVGGLTGKIK---KADAVRVITFTGCMGETYFDNKPIGLWNFREKEG--------------DCKGCTVSPQVEDSEGTIQ----------------------FDGEGYALVSRPI--RWYPNISTVMFKFRTFSSSALLMYLATRDL-KDFMSVELSDGHVKVSYDLGSGMTSVV-SNQNHNDGKWKAFTLSRIQKQANISIVDENVATSSSGNNFGLDLKADDKIYFGGLPTLKKYSGCLKDIEISRTPYNILSSPDYVGVTK------GCSLENVYTVSFP 393
15 -52.8003mw2_A mol:protein length:207 Neurexin-1-alpha  ali model follow..  90  2..............................................................................................................................................................................................................................PGSTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNRLAIARQRIPYRLGRVVDGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV............ 207
16 -52.1003mw3_A mol:protein length:208 Neurexin-2-beta  ali model follow..  70  2.............................................................................................................................................................................................................................PGSTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGERLAIARQRIPYRLGRVVDGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEGHLRL............. 207
17 -50.2001pz7_A mol:protein length:204 Agrin  ali model follow..  12  1..................................................................................................................................................................................................EKVIIEKAAGDAEAIAF-DGRTYMEYHNAVT--KSPDALDYPAE----PSEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLR-STVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSPLG-ATQLDTDGALWLGGMERSTGFIGCIRDVIVDRQE-LHLVEDALNNPTILHCSA.............. 203
18 -47.1001q56_A mol:protein length:195 Agrin  ali model follow..  14  1.....................................................................................................................................................................................................................GSEKVIIEKAAGEAIAFDGRTYMEYHNAVKSEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLR-STVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSPL-GATQLDTDGALWLGGMERSTGFIGCIRDVIVDRQE-LHLVEDALNNPTILHCSA.............. 194
19 -45.5001pz8_A mol:protein length:201 Agrin  ali model follow..  14  1.......................................................................................................................................................................................................................EKVIIEKAAGEAIAFDGRTYMEYSNEIPAEKALQSNHFELSIKTEATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLR-STVPINTNHWTHIKAYRVQREGSLQVGNEAPITGSSPL-GATQLDTDGALWLGGMERSTGFIGCIRDVIVDRQE-LHLVEDALNNPTILHCSA.............. 200
20 -45.2003sh4_A mol:protein length:195 LG3 peptide  ali model follow..  18  1.DAPGQYGAYFHDDGFLAFPGHVPEVPETIELEVRTSTASGLLLWQGGQGKDFISLGLQDGHLVFRYQLGSGEARLV--SEDPINDGEWHRVTALREGRRGSIQVDGEEVSGRSPGPNVAVNAKGSVYIGGAPD---VATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQ------HRAQAGANTRPCPS....................................................................................................................................................................................................................... 195
21 -45.1003v64_A mol:protein length:191 Low-density lipoprotein receptor-related prot  ali model follow..  22  10RTYIEYLNAVIESELTNEIPAEKALQSNHFELSLRTEATQGLVLWIGKERADYMALAIVDGHLQLSYDLGSQPVVLR--STVKVNTNRWLRIRAHREHREGSLQVGNEPVTGSSPLGATQLDTDGALWLGGLQK-LPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDAVTKPEL--------------RPCPT....................................................................................................................................................................................................................... 190
22 -44.8002h0b_A mol:protein length:184 Neurexin-1-alpha  ali model follow..  22  2...........................................................................................................................................................................................................................SKEE--YIATFKGSEYFCYDLSQN-PIQSSSDEITLSFKTLQRNGLMLHTGKS---ADYVNLALKNGAVSLVINLGSGEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQE-DYTMLGSDDFFYVGGSPSSNNFMGCLKEVVYKNNDVSRLAKQGDPKMKIHG................. 183
23 -44.1001qu0_A mol:protein length:191 LAMININ ALPHA2 CHAIN  ali model follow..  17  8.....ESGTYFDGTGFAKAGGFKVGLDLLVEFEFRTTRPTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDIPGHMCNGQWHKVTAKKIKNRLELVVDGNVDAQSPNSASTSADTNDPVFVGGFPGGLN---QFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALEL--------RGVQPVSCP........................................................................................................................................................................................................................ 189
24 -44.0002r16_A mol:protein length:182 Neurexin-1-alpha  ali model follow..  21  5................................................................................................................................................................................................................................ATVLSYDGSMFMKIQLPVV--MHTEAEDVSLRFRSQRAYGILMAT-TSRDSADTLRLELDAGRVKLTVNLGKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAG-DHTRLEFHN-IETGIITEPSNFIGHLQSLTFNGMAYIDLCKNGDID...................... 169
25 -43.6003pve_A mol:protein length:189 Agrin, Agrin protein  ali model follow..  24  4NAGSRPFLADFNGFSYLELKGLHLGEKMALEMVFLARGPSGLLLYNGQGKGDFVSLALHNRHLEFRYDLGKGAAIIR--SKEPIALGTWVRVFLERNGRKGALQVGDGRVLGESPVPHTMLNLKEPLYVGGAPD--FSKLARGAAVASGFDGAIQLVSLRGHQLLTQEHVLRAVD........................................................................................................................................................................................................................................... 183
26 -40.9001d2s_A mol:protein length:170 SEX HORMONE-BINDING GLOBULIN  ali model follow..  13  13...........EPIAVMTFDLTKI-TKTSSSFEVRTWDPEGVIFYGDTPKDDWFMLGLRDGRPEIQLHNHWAQLTVG--AGPRLDDGRWHQVEVKMEGDSVLLEVDGEEV---LRLRQVSGHPIMRIALGGLLFPASNLRLP---LVPALDGCLRRDSWLDKQAEISASAPTSLR-----------SC.............................................................................................................................................................................................................................. 170
27 -39.4001f5f_A mol:protein length:205 SEX HORMONE-BINDING GLOBULIN  ali model follow..  14  25...........EPIAVMTFD-LTKITKTSSSFEVRTWDPEGVIFYDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVG--AGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSTSKRHPIMRIALGGLLFPASNLRLP---LVPALDGCLRRDSWLDKQAEISASAPTSLRS-------------------------------------------CDVESNPGIFLPPGTQA.............................................................................................................................................................................. 204
28 -19.0004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  25  46.........................................................................................................................................................................................QACRTNPCLHGGRCLEVEGHRLCHCP-VGYTGPFCDVDTAA........................................................................................................................................................................................ 85
29 -18.4001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  21  9..................................................................................................................................................KQGNLECLEEACSLEEAREVFEDA--EQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCA-EGFEGKNCEFSTR......................................................................................................................................................................................... 86
30 -18.2001fax_L mol:protein length:96 FACTOR XA  ali model follow..  27  5.........................................................................................................................................................................................DQCETSPCQNQGKCKDGLGEYTCTCL-EGFEGKNCELFTRK........................................................................................................................................................................................ 44
31 -18.0004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  21  11.................................................................................................................................GGICLPGLADGSFSCECPDGFTDCTPNPCHNGGTCEISEAYRGPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECP-GEFMGRNCQYKGG......................................................................................................................................................................................... 136
32 -17.8001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  16  9..................................................................................................................................................RPGSLECKEEQCSFEEAREIFKDAERTKLFWI--SYSDGDQCASSPCQNGGSCKDQLQSYICFCL-PAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADG................................................................................................................................................... 124
33 -17.6001za4_A mol:protein length:251 Thrombospondin 1  ali model follow..  13  75...........................................................................................................................................................................................................................................................LLLASLRMKKTRGTLLALERKDHSGQVFSVVSKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLALRIAKGGVNDNFQGVLQNVRF..................................... 203
34 -17.6001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  18  7..................................................................................................................................................EEFVRGNLERECIEEKCSFEEARENTEKTNEFWKQYVDGDQCEPNPCLNGGLCKDDINSYECWCQ-VGFEGKNCELDATCNI...................................................................................................................................................................................... 90
35 -17.2004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  25  2....................................................................................................................................................................................DIVDGDQCESNPCLNGGSCKDDINSYECWCP-FGFEGKNCE............................................................................................................................................................................................. 41
36 -16.9001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  29  44....................................................................................................................................................................................HSVPVKSCSEPRCFNGGTCQQAFSDFVCQCP-EGFAGKSCEIDTRAT....................................................................................................................................................................................... 91
37 -16.9004c1w_A mol:protein length:188 NEURAMINIDASE  ali model follow..  12  1........................................................................................................................................................................................................................GAMVIEKEDVETNASNGQRVDLSSELDKLKKLENATVHMEFKPDAKAPNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGKNNYNDAPLKVKPGQWNSVTFTVEKGRVRLYVNGVLSRTSLRSGNFIKDMPDVTHVQIGATKRANNSNLQIRNLTVTPEEVQKRS............................ 188
38 -16.8002v73_A mol:protein length:191 PUTATIVE EXO-ALPHA-SIALIDASE  ali model follow..  12  16................................................................................................................................................................................................................................GNLKITKEEERVNITGDLEKFSSLEEGTIVTRFNMNDTSQSLIGLSDGNKANNYFSLYVSGGKVGYELQEGNGDFNVHHSADVTFNRGINTLALKEKGIGAKIFLNGSLVKTVSDPNIKFLNAINLNSGFIGKTDRANGFRGNIDFMNIYDKPVSD.............................. 180
39 -16.8001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  18  2..................................................................................................................................................................................TSHLVKCAEKEKTFCVNGGECLSNPSRYLCKCQ-PGFTGARCTENVPMKVQNQEKAEELYQ........................................................................................................................................................................... 66
40 -16.7001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  19  12........................................................................................................................................................CMEETCSYEEAREVFEDSDKTNEFWN--KYKDGDQCETSPCQNQGKCKDGLGEYTCTCL-EGFEGKNCELFTRKL....................................................................................................................................................................................... 83
41 -16.5001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  20  9..................................................................................................................................................KKGHLECMEETCSYEEAREVFEDSDKTNE-----KYKDGDQCETSPCQNQGKCKDGLGEYTCTCL-EGFEGKNCELFTRKL....................................................................................................................................................................................... 88
42 -16.4004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  24  30..................................................................................................................................................LQGYTGCISNPCQNDATCLDQIGEFQMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCP-KGFSGHLCQSGRLEVLF..................................................................................................................................................................................... 123
43 -16.2001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  25  4.........................................................................................................................................................................................DQCASSPCQNGGSCKDQLQSYICFCL-PAFEGRNCETHKDDGSA..................................................................................................................................................................................... 46
44 -16.1001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  37  1........................................................................................................................................................................................TASCQDMSCSKQGECLETIGNYTCSCY-PGFYGPECEYVRE......................................................................................................................................................................................... 40
45 -16.0002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  24  33..................................................................................................................................................LQGYTGCVSNPCQNDATCLDQIGEFQMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECP-TGFTGHLCQVDLHHILD..................................................................................................................................................................................... 126
46 -15.9001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  21  1...................................................................................................................................................................................NSYPGCPSSYDGYCLNGGVCIESLDSYTCNCV-IGYSGDRCQTRDLRWWELR................................................................................................................................................................................... 53
47 -15.8001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  25  11.....................................................................................................................................................................................VLPLEHPCASLCCGHGTCIDGIGSFSCDCR-SGWEGRFCQREVSF........................................................................................................................................................................................ 54
48 -15.7005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  23  67..................................................................................................................................................RATHTGCSPSPCQNGGTCRPTGDVTHEPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCP-PEWTGQYCTE............................................................................................................................................................................................ 154
49 -15.6005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  23  70..................................................................................................................................................RATHTGCSPSPCQNGGTCRPTGDVTHEPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCP-PEWTGQYCTE............................................................................................................................................................................................ 157
50 -14.8004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  17  152..................................................................................................................................................SDNYYGCSRLCK-GHYECQPDGSPSCLPGWTGKYCD--QPICLSGCHEQNGYCS---KPDECNCR-PGWQGPLCNEAA.......................................................................................................................................................................................... 230
51 -14.5004qvs_A mol:protein length:227 S-layer domain-containing protein  ali model follow..  13  47.....NSVSLDGVDDYVALPDAGTFYNFTIAFWVRLDTIGEFDFFDSGSNNKYMRLTAEDGKIKFAMTQSGYYGEKTITSGSALTEGVWKHVAVTLSGDTGTLYINGENVGENNTLSLRPLTFTSKGYIG---KSHQTDSSEDPYYNSYLHGMIDDFRIFDRALSADEIKTLASVATR........................................................................................................................................................................................................................................ 225
52 -14.1004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  23  206.................................................................................................................................GCSPKHGSCKLPGDCRCQYGWQGCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCTHQPCLNGGTCSNT-DKYQCSCP-EGYSGPNCEIV........................................................................................................................................................................................... 305
53 -14.1002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  24  82..................................................................................................................................................QYGWQGCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCTHQPCLNGGTCSNT-DKYQCSCP-EGYSGPNCE............................................................................................................................................................................................. 162
54 -14.0001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  25  1...................................................................................................................................................................................NSYPGCPSSYDGYCLNGGVCIESLDSYTCNCV-IGYSGDRCEHA........................................................................................................................................................................................... 45
55 -13.1003ltf_D mol:protein length:58 Protein spitz  ali model follow..  28  5.........................................................................................................................................................................................YKCPEWYCLNDAHCIADLPVYSCECA-IGFMGQRCEYKE.......................................................................................................................................................................................... 50
56 -12.9004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  16  151..................................................................................................................................................SDNYYGKKRDDHFGHYECQPDGSPSCLPGWTGKYCD--QPICLSGCHEQNGYCS---KPDECNCR-PGWQGPLCNECIPHKGCRHGTCTIPWQ........................................................................................................................................................................... 244
57 -12.6002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  13  1..........................................................ETGSLYLWIDAHQARVLIGFEEDI-VSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEF-GTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPG-GCRNGGFCN---ERRICECP-DGFHGPHCEGT........................................................................................................................................................................................... 181
58 -12.1001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  16  1....................................................................................................................................................GSHMRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRK-CIH-GECVKELRAPSCICH-PGYHGERCHG............................................................................................................................................................................................ 77
59 -11.7003fuq_A mol:protein length:417 BoNT/F (Neurotoxin type F)  ali model follow..  47.......GIYSSKPSEVNIAQ-GRYQNFSISFWVRIPKYFNTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNNYTQMISISDYINKWIFVTITNNRGNSRIYINGNLIDEKSISNLGDIHVSDNILFK------------IVGCNDTRYVGIRYFKVFDTELGKTEIETLYSDEPDPS-NKRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSNTRLYTGVEVIIRKNGSTDISNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKLIRTSNTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTSSNGISKEH............................................................................... 412
60 -11.6001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  25  3........................................................................................................................................................................................APSSYDGYCLNGGVAIESLDSYTCNCV-IGYSGDRCQTR........................................................................................................................................................................................... 42
61 -11.5001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  13  2......................................................................................................................................................................................SSEHRCIDTNVPENAACYRY-GTEEWRCL-LYFDAGKCVPAPNMTCKDKNGGCAPEAECKMNDKNEIVCKCTKEGSEPLFEGVF................................................................................................................................................ 87
62 -11.4003cfw_A mol:protein length:164 L-selectin  ali model follow..  15  7......................EKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRK-------------IGGIWTWV-----------------------GTNKSLTEEAENWGDGEPNN-----------KKNKEDCVE-IYIKRNKDAGKWNDDACHKLKAALCY--TASCQPWSCSGHGECVEIINNYTCNCD-VGYYGPQCQFVQV......................................................................................................................................................................................... 158
63 -11.2004kbb_A mol:protein length:459 Botulinum neurotoxin type B  ali model follow..  63........LTSSANSKIRVTQ-SVFLDFSVSFWIRIPKHNEYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIREVIANGEIIFK-----------LDGDIDRTQFIWMKYFSIFNTELSQSNIEE............................................................................................................................................................................................................................................... 235
64 -11.0002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  17  6.........................................................................................................................................................................................HTCIDTNVPDNAACYRYLDGEEWRC-LLTFEGGKCVPASNVTCKDNNGGCAPEAECKMTDSNKIVCKCTKEGSEPLFEGVF................................................................................................................................................ 88
65 -11.0005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  24  33.........................................................................................................................................................................................TKCSSD-CLHGQCILVDMSQNYCRCE-VGYTGVRCEH............................................................................................................................................................................................ 72
66 -10.9003flp_A mol:protein length:217 SAP-like pentraxin  ali model follow..  13  14......................................................................................................................................................................................................................................TQNPKFPHLRFMQTLPAVRQLTVCQRIKPFHRNTGYIFSCATSNQDNQFITSMSDGTLNLGLQVNASSNKYISCPIEIELGQWYHVCHVWSGVDGAVYANGSPCGTMENSAGGTVVIGQEQDKIGGGFEEQESWSGELSDLQV..................................... 168
67 -10.8005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  21  185...................................................................................................................................................................................ECRCRDQSRDRSLCHGKGFLE------ICRCD-TGYIGKNCE............................................................................................................................................................................................. 221
68 -10.7003r4s_A mol:protein length:443 Botulinum neurotoxin type C1  ali model follow..  73......................SMYESFSISFWIRINKWVSYTIIDSVKNNSGWSIGIISNFLVFTLKQNEDSEQ-YDISNNAPGYNKWFFVTVTNNMGNMKIYINGKLIDTIKVKELTGINFSKTITFE---INKIPDTGLITSDSDNINMWIRDFYIFAKELDGKDINILFNSLQYTNVVKDYWG-----------------------NDLRYNKEYYMVNIDYLNRYMYANSRQIVFNTRRNNNDFNEGYKIIIKRIRGNTNDTRVRGGDINNKAYNLFMKNETMYADNHSTEDIYAIGLREQTKDINDNIIFQIQPMNNTYYYASQIFKSNFNGENISGICSIGTYRFRLGGDTVKQGNYASLLESTSTH.................................... 423
69 -10.6003pme_A mol:protein length:420 Type C neurotoxin  ali model follow..  41.....NDFKLSSSGDKIIVNL-AIYENSSVSFWIKISKDLTYTIINSIKQNSGWKLCIRNGNIEWILQDINRKYDYSESLSHTGYTNKWFFVTITNNIGYMKLYINGELKQSERIEDLDEVKLDKTIVFG-----------IDENIDENQMLWIRDFNIFSKELSNEDINI............................................................................................................................................................................................................................................... 212
70 -10.6003azv_A mol:protein length:443 D/C mosaic neurotoxin  ali model follow..  10  79......................AMYESFSISFWIRINKWVSYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQ-YDISKNAAGYNKWFFVTITTNMGNMMIYINGKLIDTIKVKELTGINFSKTITFQM---NKIPNTGLITSDSDNINMWIRDFYIFAKELDDKD.................................................................................................................................................................................................................................................. 230
71 -10.6003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  29  2.....................................................................................................................................................................................TSHLVKCAEK-CVNGGECLSNPSRYLCKCP-NEFTGDRCQN............................................................................................................................................................................................ 49
72 -10.6001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  26  4.........................................................................................................................................................................................SECPLSHCLHDGVCIEALDKYACNCV-VGYIGERCQYR........................................................................................................................................................................................... 45
73 -10.5004isq_A mol:protein length:431 Neurotoxin  ali model follow..  10  70......................AMYESFSISFWIRINKWVSYTIIDSVKNNSGWSIGIISNFLVFTLKQNENSEQ-YDISKNAAGYNKWFFVTITTNMGNMMIYINGKLIDTIKVKELTGINFSKTITFQM---NKIPNTGLITSDSDNINMWIRDFYIFAKELDDKDINI............................................................................................................................................................................................................................................... 224
74 -10.5003obr_A mol:protein length:434 Botulinum neurotoxin type D  ali model follow..  10  48.....NDFKLSSSGDKIIVNL-AIYENSSVSFWIKISKDLTYTIINSIEQNSGWKLCIRNGNIEWILQDVNRKYK-SESLSHTGYTNKWFFVTITNNIGYMKLYINGELKQSQKIEDLDEVKLDKTIVFGI-----------DENIDENQMLWIRDFNIFSKELSNED.................................................................................................................................................................................................................................................. 216
75 -10.5001d0h_A mol:protein length:469 PROTEIN (TETANUS TOXIN HC)  ali model follow..  89......................DMFNNFTVSFWLRVPKVSA---KHSLSIGSGWSVSLKGNNLIWTLKDSAGEVR-LPDKFNAYLANKWVFITITNDRSSANLYINGVLMGSAEITGLGAIREDNNITLKL-----------DRCNNNNQYVSIDKFRIFCKALNPKEIEK............................................................................................................................................................................................................................................... 247

FFAS is supported by the NIH grant R01-GM087218-01
1 1 5 0 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.