current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3ai9_X mol:protein length:211 UPF0217 protein MJ1640, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst GSHMASMREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCMTMMHNVLDKKRICEILast
1 -108.0003ai9_X mol:protein length:211 UPF0217 protein MJ1640  ali model  100  1GSHMASMREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCMTMMHNVLDKKRICEI 211
2 -108.0003aia_A mol:protein length:211 UPF0217 protein MJ1640  ali model follow..  98  1GSHMASMREFIFKANKTITSSDINLKDLPGSCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPDERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEGKNIYYLHMNGEDVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCITIIHNVLDKKRICEI 211
3 -86.1002qmm_A mol:protein length:197 UPF0217 protein AF_1056  ali model follow..  44  1...SNAVRGFLIVGNKAFTQP-FSLNDLPG-AGRMDVLCRCTSQALFISHGIRRDVEVYLLLLGPPSPPKSILIKGDEVRRMSPDERNVAGHIKKALAV------ECGKSWKKVHSGVYVSRKGLEELIEELSEKY-SIIYLKEDGVDISNAQLPNPLFVIGDHEGLTEEQEKVVERYAALKLSLSPLSLLAEQCVVIAHHHLDRLQF... 197
4 -78.6002qwv_A mol:protein length:208 UPF0217 protein VC_A1059  ali model follow..  26  2NAMRNTMRSFILRARSAPTDSQRLLDEIGG-KCHTEILAHCMMNSLFTAQSHREDVVIHLVLESTRDYSRTITVEANEISDVGGHEAALIALLVKALDASVGM---GKEQTRVVQPGLTVRTISFEALLGEL-AEHHSLYMMDKKGDSIRDIKIPNPCFILTDHIPMPKKSGNSMKRLGVEKISLGPKMLFASQCVTLIHNEIDHQEAG.. 207
5 -10.2002egv_A mol:protein length:229 UPF0088 protein aq_165  ali model follow..  13  50...................................REDKREISCEIVEELETKLPPKDITLYQSVTVDLKTMDTIVRQATELGVLERSFQKEILKKTEKWKRIVIEAMKQSRRPIPMEIKKPVRLSDLIPESEENIILDNFYEGVKPKDVNLEAKTYSVVVGPEGGFSKRESQILREKGFKSVLLEPYTLRTETAVVSIVSIL........ 226
6 -9.9702v3j_A mol:protein length:258 ESSENTIAL FOR MITOTIC GROWTH 1  ali model follow..  12  85..............................SEARPDITHQCLLTLL--DSPINKAGKLQVYIQTSRG--ILIEVNPT---RIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLLKV----------IKNPITDHLPTKCRKVTLSFDAPVIRVQDYESICVFVG---AMARGKDNFADEYVDEKVGLSNYPLSASVACSKFCHGAEDA..... 248
7 -9.2304l69_A mol:protein length:263 Ribosomal RNA small subunit methyltransferase  ali model follow..  41..........LVLGDGVGRLARCVVEQAGRGGLRARVLRRWSVPPVTVVQALPKSERSELAIELATEAGADAFLAWQAARCVANWDGARVDKGLRRWRAVVRSAARQSRRARIPPVDGVLSTPMLVQRVREEVAAGAAVLVLHEEATDIAAAQAGSLMLVVGPEGGIAPDELAALTDAGAVAVRLGPTVLRTSTALGAVGVLTSR...... 247
8 -8.5201v6z_A mol:protein length:228 hypothetical protein TTHA0657  ali model follow..  11  72............................................EVVLYVALLKGDKLAEVVR------AATELGATRIQPLVTRHSVPKEMGEGKLRRLRAVALEAAKQSGRV----VVPEVLPPIPLKAVPQVAQGLVAHVGATARVREVPEKPLALAVGPEGGFAEEEVALLEARGFTPVSLGRRILRAETAALALLALC........ 222
9 -8.5101vhk_A mol:protein length:268 Hypothetical protein yqeU  ali model follow..  43..........IICCSQDGFEAKCELQSVSKDKVSCLVIEWTLPIKVYIASGLPKGDKLEWIIQKGTELGAHAFIPFQAARSVVKLDDKKAK---KKRERWTKIAKEAAEQSYRNEVPRVMDVHSFQQLLQRMQDFDKCVVAYEESSKQGEISAFSSLLIVFGPEGGLTEAEVERLTEQDGVTCGLGPRILRTEYALSAISYQTELLRGDQ. 258
10 -8.4203kw2_A mol:protein length:257 Probable r-RNA methyltransferase  ali model follow..  25........GHILRVLRMQAGDRLRLTDGRGSFFDAVIETKSCYVSVCGQESWQKPWRDRITIAIAPTKEKLVEIGVDEVVFIESEHERLERIAISAMKQSLKASFPVIRVNIPIQTVIADTPKAAVRLIAYVDEAVRAEITQGRGYPSDFYHVGQDVLILIGPEGDFSPSEVESALLAGFAPVSLGESRLRTETAGLVACQWIH....... 240

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.