current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3afm_A mol:protein length:258 Carbonyl reductase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKHLast
1 -109.0003afm_A mol:protein length:258 Carbonyl reductase  ali model  100  1MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH 258
2 -108.0004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  97  1MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH 258
3 -106.0004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  67  1MFSDLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASAKASGTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITGQILDVNGGQIC. 257
4 -106.0004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  64  1MFSDLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASAKASGTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASGYITGQILDVNGGQIC. 257
5 -95.0003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  33  3.LQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKG-------GAIVTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTFTPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAA-YVTGACYDINGGVLF. 250
6 -94.0004yqy_A mol:protein length:270 Putative Dehydrogenase  ali model follow..  35  18...DLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEG-------SSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPK-IRVNSLCPGMIDTDFHNIFTPEVRTHVANVSPVKREGTSEDVAKLAVFLASDDAA-FITGANVDINGGMLF. 263
7 -92.6003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  29  5.MFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAG-VFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIAS-----GSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAG-YITGQAIAVDGGQVL. 253
8 -91.7001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  29  1......SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAG-ITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKK-----RKGRIINIASVVGLI-GNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLALSPAASYITGQAFTIDGGIAI. 244
9 -91.2002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  31  2....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAG-VTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQ-----RHGRIVNIASVVGVT-GNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSK-YITGQTLNVDGGMVM. 246
10 -90.8002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  32  2...QLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAG-ITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQ-----KSGKIINITSIAGII-GNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSN-YITGQVINIDGGLVM. 247
11 -90.4004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  28  2...KLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCD-VQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAG-ITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQ-----GKGVILNASSVVGLY-GNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDAS-YVNGVAIEASGGMSL. 246
12 -90.4003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  29  2....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAG-ITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQ-----RSGAIINLSSVVGAV-GNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAK-YITGQTIHVNGGMYM. 246
13 -90.0003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  30  29VMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAG-IFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLTAS-----GRGRVILTSSITGPVTGYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAG-YITGQAIVVDGGQVL. 278
14 -90.0004jro_A mol:protein length:271 FabG protein  ali model follow..  28  18.AMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAG-ITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQ-----RAGKIINMASVVGLI-GNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASK-YITGQTLSVDGGMVM. 265
15 -89.5003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  23  1MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAG-VFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQ-----NFGRIINYGQGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDD-SDMITGTIIEVTGAVDV. 253
16 -89.1004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  31  18.AMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAG-VVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMSKS-----RFGSVVNVASIIGER-GNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSS-YITGETLKVNGGLYM. 265
17 -88.8004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  28  5LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAG-ITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSN----GCRGSIINISSIVGKV-GNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSG-YITGTSVEVTGGLFM. 261
18 -88.6003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  28  9...HLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDL-KSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAG--GGGPKPFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKA-----GGGAILNISSMAGEN-TNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSP-AAAWISGQVLTVSGGGVQE 254
19 -88.4004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  33  1MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN-----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAG-ITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQ-----GKGKIINTSSVTGTY-GNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESD-YVNGHVLHVDGGIMM. 244
20 -88.4004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  29  2...STDKRVAIITGAANGIGRATALEFAQAGYHV-VAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAG-ILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAA-----KYGRILNASSVVGLY-GNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESG-FISGTTLSVDGGMVV. 255
21 -88.4002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  28  1MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDL-DRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAG-ITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSN----GCRGSIINISSIVGKV-GNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSG-YITGTSVEVTGGLFM. 257
22 -88.3004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  32  1.MTALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAG-ITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQ-----KSGRIINITSVAGMM-GNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNAE---PILQFIPLARYGQPEEVAGTIRFLATDPAAAYITGQTFNVDGGMVMF 247
23 -88.3005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  28  1.MKRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAAR-SEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNLDKNLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVG-----GGSIVNISTIGSVV-PDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDD-SGYVTGMIHEVAGGFALG 252
24 -88.1004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  26  15LRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAG-ISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEA-----RRGWIVNTSSVAGKTYSPIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAEQVKLTPMARLGQPAEVADVALWLTSTESS-FVTGQTVDVAGGLYM. 266
25 -88.0004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  26  3MGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAG-LTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRD----RVEGAIVNVSSMSSMG-GQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEE-SGLMTGAIVNFDQSVWG. 259
26 -87.7001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  30  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAG-LENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVEN----DIKGTVINMSSVHEKI-PWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEAS-YVTGITLFADGGMTLY 253
27 -87.5001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  29  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAG-LANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVEN----DIKGTVINMSSVHEKI-PWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEAS-YVTGITLFADGGMTQY 253
28 -87.4003woh_A mol:protein length:251 SiaM  ali model follow..  31  5GPGALSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAG-IIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFIRK-----RSGSIINISSVSGVF-GSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK--RLDPVPMRRFGRPDEVAGLVAFLAGDESS-YITGQVVCVDGGMAM. 251
29 -87.4004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  27  14.MNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFG-ETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAG-ITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDA-----KKGVIINTASVTGIF-GSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLAS-GITATTVSVDGAY... 260
30 -87.3003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  22  2....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAA-SGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKN-----GGGHIVSISSLGSIR-YLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKAD-MIRGQTIIVDGGRSL. 248
31 -87.3001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  26  1MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDM-NREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-----YGRIVNTASMAGVK-GPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSS-FMTGVNLPIAGG.... 262
32 -87.1003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  30  3MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAG-VENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVEN----DIKGNVINMSSVHEMI-PWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQAS-YVTGITLFADGGMTKY 255
33 -87.0003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  29  4.SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADI-NAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAGGMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKR-----GGGAIVNQSSTA----AWLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEAS-WITGQIFNVDGGQIIR 252
34 -86.6002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  30  1MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAG-ITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQ-----RWGRIVNISSVVGFT-GNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELAS-YITGEVIHVNGGMF.. 248
35 -86.6004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  31  17.ALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAG-ITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIMLKQ-----RSGRIINIASVVGEM-GNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAAE---KLLEVIPLGRYGEAAEVAGVVRFLAADPAAAYITGQVINIDGGLVM. 262
36 -86.5001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  24  8...RLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAG--GGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKN-----GGGVILTITSMAAEN-KNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSP-AASWVSGQILTVSGGGVQE 253
37 -86.4003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  26  1MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAG-ITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVER-----GWGRIINISSVNGQK-GQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEE-SGFSTGADFSLNGGLHM. 249
38 -86.4004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  29  14FQSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAG-IARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGAR----QGGRIITLSSVSGVM-GNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKE-AMSMIPMKRMGQAEEVAGLASYLMSDIAG-YVTRQVISINGGML.. 261
39 -86.3003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  27  5MGGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAAR-TVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVPSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPALEE------SKGAVVNVNSMVVRH-SQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYVEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLAS-GITGQALDVNCGEYK. 263
40 -86.2004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  29  2LSLGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATDGG-----------NTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAG-ITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYER-----KAGSIVAISSISGER-GNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPVASSYVTGEVLRVNGAHH.. 239
41 -86.1002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  33  2.......RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVAVGANLLEAEAATALVHQAAEVLGGLDTLVNNAG-ITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMMKA-----RFGRIVNITSVVGIL-GNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAG-YITGQTLCVDGGLTPH 245
42 -86.0004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  26  9RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMD------LAPRLAATRYEEPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGAGKGRSARIITIGSVNSFM-AEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSS-FITGSTITIDGGLSA. 260
43 -85.9004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  29  1.MKKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGD----------LGDLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAG-ITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTN-----GYGSIINISSVVGVF-GNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDAS-YVTGQTINVNGGMRL. 240
44 -85.8001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  27  11...SFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAG-VSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQ----KQQKGSIVVTSSMSSQINGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSD-HATYMTGGEYFIDGGQLI. 264
45 -85.6004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  33  3.TQDLSGKIALVTGASRGIGAAIADTLAAAGAKV-IGTATSESGAAAISERLAQWGGEGRVL--NSAEPETVENLIADIEKTFGKLDILVNNAG-ITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMMKQ-----RAGRIINITSVVGVM-GNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAK-YITGQTLHVNGGMLM. 247
46 -85.5003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  26  7.IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDV----MAAQAVVAGLENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAG-VSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLAS----NTKGVIVNTASLAAKV-GAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQERTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAAR-FMTGQGINVTGGVRMD 263
47 -85.5005iz4_A mol:protein length:271 Putative short-chain dehydrogenase/reductase  ali model follow..  27  3.MTQSSTPVCVITGSASGIGAATALRFAQAGWSVAIGNDSTRDAASTVEALCRDAGAQTLIFDADVGKDADCRHAVDMVASRWQRIDALINCAG-VIPHNAFDQIDDFEFERVYRVNLIGLYQMTRAAVPLLRESASAT-RSTSVVNVSSLAGLN-GTGSSIAYAASKGAVNTLTLSLARNLAPH-IRVNALAPGMVDDGLLLRVYDGVLSRMTESAPLKRVSRPAEIAELAWFLTAH--APAITGQVIAAENGLLLG 263
48 -85.4003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  30  2...SLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAG-ITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKK-----RWGRIISIGSVVGSA-GNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAK-YITGQTLHVNGGMYM. 246
49 -85.4003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  28  5...GSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAG-ITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADR-----GWGRIVNISSVNGQK-GQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEE-SGFSTGADFSLNGGLHM. 250
50 -85.3004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  29  3MTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADL-LDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAG-VISIHPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQ-----GRGRIINVASIAGKE-GFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKRHQLTLIPQGRAQTPEDMGRLALFFATM---DNVTGQAVNVDGGFTFH 260
51 -85.3004mow_A mol:protein length:256 Glucose 1-dehydrogenase  ali model follow..  26  3.MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAADAQRIVDTAIETYGRLDVLVNNSG-VYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEG-------ASIINISSVVTSI-TPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSIGSDLEAQVLGQTPLGRLGEPNDIASVAVFLASDD-ARWMTGEHLVVSGGL... 249
52 -84.8004qec_A mol:protein length:248 ElxO  ali model follow..  28  2......KKNVLITGGFKGIGKQVALEFLKNDYHVCITS-RYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKV-----SCGAIVNISSITGLS-GFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNN-FITGHVLSIDGGYLSQ 248
53 -84.8001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  28  2...RLKDKAVLITGAAHGIGRATLELFAKEGARLVACDI-EEGPLREAAEAVGAHP-----VVMDVADPASVERGFAEALAHLGRLDGVVHYAG-ITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREK-----NPGSIVLTASRVYL--GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESS-FITGQVLFVDGGRTI. 240
54 -84.7002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  23  28YYYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAG-ITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINN-----RYGRIINISSIVGLT-GNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSG-YINGRVFVIDGGL... 273
55 -84.6001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  27  2...RLDGKTALITGSARGIGRAFAEAYVREGARVAIADINL----EAARATAAEIGPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAA-LFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAG----GRGGKIINMASQAGRR-GEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPE-ADYIVAQTYNVDGGNWMS 256
56 -84.6002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  26  11...PLENKVALVTASTDGIGLAIARRLAQDGAHVVVSS-RKQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKR-----GGGSVLIVSSVGAYH-PFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDAS-YITGETVVVGGGTASR 259
57 -84.6001xkq_A mol:protein length:280 short-chain reductase family member (5D234)  ali model follow..  32  1.MPRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGR-SSERLEETRQIILKSGKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAG-AAIPDAFGTTGTDIYHKTLKLNLQAVIEMTKKVKPHLVA------SKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSL. 264
58 -84.6003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  29  3...RLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINA----EGAKAAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNAS-IVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAA----GKAGRVISIASNTFFA-GTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDAR-WITGQTLNVDAGMVRH 247
59 -84.6004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  28  15FQGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAG-ITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADR-----GWGRIVNISSVNGQK-GQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEE-SGFSTGADFSLNGGLHM. 263
60 -84.5004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  27  2MMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDI----ERARQAAAEIGPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAA-LFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQ----GRGGKIINMASQAGRR-GEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDAEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAE-SDYIVSQTYNVDGGNWMS 259
61 -84.5004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  30  2...AMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAG-ITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMVER-----GWGRIVNISSVNGSK-GSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILDKILPQIPAGRLGKPEEVAALVAYLCSEE-AGFVTGSNIAINGGQHMH 249
62 -84.4004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  31  1MAMRFKDKVVIVTGGASGIGEATARAFIREGAKVVI--ADFSDHGQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAG-IAADAPIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQG-----GGVIVNCGSIHSHV-GKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNIPDDKKQALVALHPMGRLGRAEEVANAVLFLASDEAS-FVNGASLLVDGGYTAQ 248
63 -84.4004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  29  15QSMSLQGKVALVTGASRGIGQAIALELGRLGAVV-IGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAG-ITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKA-----RWGRIINIGSVVGAM-GNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAA-YVTGATVPVNGGMYM. 262
64 -84.4003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  30  16MDKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAG-ITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKA-----RGGRIVNITSVVGSA-GNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAG-YITGTTLHVNGGMFM. 263
65 -84.4005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  28  2.MELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDI-DGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKA------AKGNVVHLCSVAGFV-SGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMAS-YITGTILPVDGGFLA. 250
66 -84.4004da9_A mol:protein length:280 Short-chain dehydrogenase/reductase  ali model follow..  26  17MMTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGASIVRDDFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLAS--DARASRSIINITSVSAVM-TSPERLDYCMSKAGLAAFSQGLALRLAETGIAVFEVRPGIIRSDMTAAVSGKYDGLIESGVPMRRWGEPEDIGNIVAGLAGGQFG-FATGSVIQADGGLSI. 271
67 -84.3001spx_A mol:protein length:278 short-chain reductase family member (5L265)  ali model follow..  32  1.MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGR-HAERLEETRQQILAAGQNVNSVVADVTTDAGQDEILSTTLGKFGKLDILVNNAGAASQSKTGTAQSIESYDATLNLNLRSVIALTKKAVPHLSST------KGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFGSAMGYSTMATMKECVPAGVMGQPQDIAEVIAFLADRKTSSYIIGHQLVVDGGSSL. 264
68 -84.3003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  26  12...PLANKVALVTASTDGIGFAIARRLAQDGAHVVVSS-RKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKR-----GGGSVVIVSSIAAFS-PSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDAS-YITGETVVVGGGTPSR 260
69 -83.5002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  25  1MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADL---VPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAG-IYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRN-----GWGRIINLTSTTYWL-KIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMAIPRLQVPLDLTGAAAFLASDDAS-FITGQTLAVDGGMVRH 249
70 -83.3004one_A mol:protein length:262 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  27  1MAMSRQRPVALVTGGRRGIGLGIARALAAKGFDLAITDRES---DEAVIHELRGLGGKVAFFKSDLAAVKTHEATVFAVLDAFGGIDCLVNNAGGAVERGDFLALKPENFDTIMDVNLRGTVFFTQAVVKAMLAADEVR-FPRSIVTISSVSSVM-TSPERLDYCISKAGLTAFVQGLALRLAEARIGVFEVRPGIIRTDMTAKVAARYDALIEGGVPMKRWGEASDVGAIVAGLAGGDFI-FATGSAIHADGGLSI. 253
71 -83.3002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  28  1.MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREE----RLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAG-VAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLE-------EGGSLVLTGSVAGL--GAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESA-YITGQALYVDGGRSI. 241
72 -83.2003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  15  2.......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDE-------LEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKR-----KSGHIIFITSAAPFG-PWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFNPEHVAHVKKVTALQRLGTQKELGELVAFLASG-SCDYLTGQVFWLAGGFPM. 245
73 -83.2003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  25  2KPYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCAR-DGERLRAAESALRQRGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAG-QGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESR-----ADAAIVCVNSLLASQ-PEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREEARNKQIPLGRLGKPIEAARAILFLASPLSA-YTTGSHIDVSGGLSRH 264
74 -83.2001xhl_A mol:protein length:297 Short-chain dehydrogenase/reductase family me  ali model follow..  30  15.MARFSGKSVIITGSSNGIGRSAAVIFAKEGAQVTITGR-NEDRLEETKQQILKAGVPANAVVADVTEASGQDDIINTTLAKFGKIDILVNNAGANLADGTATDQPVELYQKTFKLNFQAVIEMTQKTKEHLIKT------KGEIVNVSSIVAGPQAHSGYPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGAVATGFMGAMGYSFIGSRKECIPVGHCGKPEEIANIIVFLADRNLSSYIIGQSIVADGGSTL. 276
75 -83.2003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  27  5...SLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDV-KQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAG-ICQVKPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEK----GTKGKIINACSIAGHE-GYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRMYKKYVEGIALGRVETADDVAGFVAYLSSSD-ADYMTGQSVLIDGGLVFR 262

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.