current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst ETGSLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGTKLast
1 -92.4002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model  100  1ETGSLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEGTK 182
2 -52.5002ygn_A mol:protein length:156 WNT INHIBITORY FACTOR 1  ali model follow..  98  1ETGSLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQGT................................. 149
3 -50.9002d3j_A mol:protein length:157 Wnt inhibitory factor-1  ali model follow..  96  8QEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCLQA................................. 156
4 -41.3002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  98  1ETGSLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKA. 181
5 -24.8002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  20  18................................................GSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGT------------HCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCE... 136
6 -24.3004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  15  136............................................................................NNTLTRLRYSYRVVCSDNYYGDSCSRLCKSPSCLPGWTGKYCDQPICLSGHEQNGYCSKPDECNCRPGWCNECIPHKGC-RHGTCTIPWQCACDEGWGGLFCDQA. 259
7 -23.9004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  17  146.......................................................................................................SYRVVCSDNYYGDSCSRCKKRDDHFGHYECQPDGSPSCLPGWCDQPICSGCHEQNGYCSKPDECNCRPGWQGPLCNEA. 229
8 -21.1004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  18  207...........................................................................CSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGI-----CNEPWQCLCETNWGGQLCDKDL------NYCGTHQPCLNGGTCSNTGQCSCPEGYSGPNCEIVD 306
9 -18.5002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  17  36..............................................................................GHYACDQNGNKTCMEGWMGPECNRAICDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCLCDKDLNYCGTHQPCLNGGTCSNTGQCSCPEGYSGPNCE... 162
10 -17.8004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  15  202.........................................................................CTACMNNGVCHETGECICPPGFMGRTCEKATCKERCSGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCERE. 321
11 -16.8004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  18  218....................................................DKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCPCKNGATCTNTGQGSYTCSCRPGYTGATCELGI-------DECDPSPCKNGGSCTNSYSCTCPPGFYGKICELS. 346
12 -16.7005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  13  198............................................................................CHGKGFLE--GICRCDTGYIGKNCECQTQGRSSQELEGS--CRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCEGRGLCFC-GKCRCHPGFEGSACQ... 313
13 -16.2005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  18  48...........................................................................LCRHGGTCHNEVRCVCRATHTGPNCERPYVPCPCQNGGTCRPTGDVTHECACLPGFTGQNCEENI-------DDCPGNNCKNGGACVNTYNCRCPPEWTGQYCTE.. 154
14 -16.1005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  31  190..................................................................................................................................................DQSRDRSLCHGKGFLEC-GICRCDTGYIGKNCEHHH 224
15 -16.1005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  18  51...........................................................................LCRHGGTCHNSYRCVCRATHTGPNCERPYVPCPCQNGGTCRPTGDVTHECACLPGFTGQNCEENI-------DDCPGNNCKNGGACVNTYNCRCPPEWTGQYCTE.. 157
16 -15.8003ltf_D mol:protein length:58 Protein spitz  ali model follow..  33  7.................................................................................................................................................CPETFDAWYCLNDAHCFPVYSCECAIGFMGQRCEYK. 49
17 -15.7001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  32  43...................................................................................................................................................DQCETSPCQNQGKCKGEYTCTCLEGFEGKNCELF. 79
18 -15.6001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  18  6..........................................................................................................EELRPGSLERECKEEQCSFEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCLQSYICFCLPAFEGRNCETH. 84
19 -15.5004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  18  2......................................................................ICDPNPCENGGICLPSFSCECPDGFTDPNCSSVVEVATCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI-------NECEVEPCKNGGICTANYSCECPGEFMGRNCQYK. 134
20 -15.5001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  17  6..........................................................................................................EEMKKGHLERECMEETCSYEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKGEYTCTCLEGFEGKNCELF. 84
21 -15.4004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  15  33..........................................................MWVLGCRSGQNVVALNIKSGDGGRTLTGTVGEGPIGFRATL---------TQSNTYAVENQWGGSSAPWHPGGTWVIGCRVNQ-----QVVALDIESGDQGATLATYAGEGPIGFKSQQADGG. 147
22 -15.4002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  17  208.........................................................................................................ICRCDTGYIGKNCECQTQGRSSQELEG------------SCRKDNNSIICSGLGDCVC-GQCLCHTSIYGQYCE... 274
23 -15.1004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  14  89..........................................................VWVLGARDKQNIVAVSIKSNDGGKTLTGTNGEGPIGFKSEV---------TDGDTYSVENQWGGSAAPWHSGGVWVLGTRGKQ-----NVINVDAKSNDGGKTLSTYNGEGPIGFRGTLTSPD. 203
24 -15.1001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  20  1.......................................................................................................SYQVICRDEKTQMIYQQHQSWLRVLRSNRVEYCWCNSGRAQCHSKSCSEPRCFNGGTCQSDFVCQCPEGFAGKSCEID. 87
25 -15.0004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  15  11...........................................................................PCEHAGKCLNTLECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQEFQCICMPGYEGVYCEINT-------DECASSPCLHNGRCVNEFLCQCPKGFSGHLCQSG. 117
26 -15.0001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  38  49...................................................................................................................................................DQCEPNPCLNGGLCKNSYECWCQVGFEGKNCELD. 85
27 -14.9002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  16  14...........................................................................PCEHAGKCINSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQEFQCICMPGYEGVHCEVNT-------DECASSPCLHNGRCLNEFQCECPTGFTGHLCQVD. 120
28 -14.8004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  41  46...................................................................................................................................................QACRTNPCLHGGRCLGHRLCHCPVGYTGPFCDVD. 82
29 -14.4001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  35  9...................................................................................................................................................AEKEKTFCVNGGECFSRYLCKCQPGFTGARCTEN. 50
30 -13.9001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  36  11.......................................................................................................................................................DGYCLNGGVCLDSYTCNCVIGYSGDRCQTR. 45
31 -13.8001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  20  6..........................................................................................................EEVKQGNLERECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGPCLNQGHCKGDYTCTCAEGFEGKNCEFS. 84
32 -13.7003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  19  364EDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRL---------------------CRNGYCTPTGKCCCSPGWEGDF----------------------------------------------CRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCE... 475
33 -13.7001fax_L mol:protein length:96 FACTOR XA  ali model follow..  32  5...................................................................................................................................................DQCETSPCQNQGKCLGEYTCTCLEGFEGKNCELF. 41
34 -13.7001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  26  15...................................................................................................................................................EHPCASLCCGHGTCIGSFSCDCRSGWEGRFCQRE. 51
35 -13.2001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  38  11.......................................................................................................................................................DGYCLNGGVCLDSYTCNCVIGYSGDRCEHAD 46
36 -12.6001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  35  48..........................................................................................................................................................CIH-GECLRAPSCICHPGYHGERCHGLS 79
37 -12.6003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  13  59VKGYLHYVFDLGNGANLIKGSSNK--LNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNLDLKSDLYI---------------------GVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQESCSNQGVCLDGFSCDCSTSFSGPLCNDP. 223
38 -12.4003cfw_A mol:protein length:164 L-selectin  ali model follow..  13  12.......WQRARRFCRDNY--TDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGT---------------------NKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRN----------KDAGKWNDDACHKLKAALCYTASCQPSCSGHGECINNYTCNCDVGYYGPQCQFV. 156
39 -12.3004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  37  7...................................................................................................................................................DQCESNPCLNGGSCKNSYECWCPFGFEGKNCELLE 44
40 -12.2005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  29  43..........................................................................................................................................................CLHGQCIMSQNYCRCEVGYTGVRCEHF. 73
41 -11.9002ddu_A mol:protein length:387 reelin  ali model follow..  12  54TTPSAMVFGKSDGDRFAVTRDLT---LKPGYVLQFKLNIGCTSQF----STAPVLLQYSHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDFEEWTRITIAIPRSLASSKTRFRWIQESSSQKNVPPFGLDGVY-----SEPCPSYCSGHGDCIS-GVCFCDLGYTAAQGTCVS 224
42 -11.8001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  28  16..........................................................................................................................................................CLHDGVCLDKYACNCVVGYIGERCQYRD 48
43 -11.8001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  32  8.......................................................................................................................................................DGYCLNGGVALDSYTCNCVIGYSGDRCQTRD 43
44 -11.7001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  29  14..........................................................................................................................................................CLHDGVCLDKYACNCVVGYIGERCQYR. 45
45 -11.6003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  44  16..........................................................................................................................................................CVNGGECFSRYLCKCPNEFTGDRCQNY. 50
46 -11.4001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  31  1..................................................................................................................................................TASCQDMSCSKQGECLGNYTCSCYPGFYGPECEYV. 38
47 -11.4001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  35  4...................................................................................................................................................DQCASSPCQNGGSCLQSYICFCLPAFEGRNCETH. 40
48 -9.9103l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  1.................................................................GSACELPECQEDAGNKVC-SLQCNNHACGWDGGDCSLNTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQC---NPLYDQYCKDHFSDGHC-DQGCNSAECEWDGLDCAEHV 120
49 -9.9103r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  15  32SARGLVLYFDDEGFCDFLELI-----LTRGGRLQLSFSIFCAEPATLLTDTPVND---AWHNVRIRRQFRNTTLFIDQVEAKWVEVKSKRRD-GGLPPELRAAALKLT-KGWIRDVRVNSSLALPVDSGEVKLDDEPPNSGGGSPCEEEGEGGVCLNGGVCSVQAVCDCSTGFRGKDCSQGK 229
50 -9.7302e26_A mol:protein length:725 Reelin  ali model follow..  11  47EEDSAMVFVSNEVGEHSI-TTRDL--VNENTIIQFEINVGCSTDS----SADPVRLEFSRDFGATWHLLLPLCYHSSSLVSSLCSTEHHPSSTYYAGTTQGWRREVVHFGKLHLCGSVRFRWYQGFYPAGSQPVTWAIDNV----YIGPQCEEMCYGHGSCINGTKCICDPGYSGPTCKIST 219
51 -9.6103zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  15  249TTKKLRDFFTVTDLR--------IRLLRPAVGEIFVDELHLARYFYAISDIKVR--------------------------------GRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGAANACIPSISSIGCQNGGTCHNNVRCLCPAAYTGILCEKLR 400
52 -9.1104z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  26  469...................................................................................................................................................DKCVSVDCGAHGTCDVATKCVCEPGFTGERCDAA. 503

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.