current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2ot9_A mol:protein length:180 Hypothetical protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MAQPSTTYKFELNLTDLDRGVYESVKQTIARHPSETEERMTVRLLAYAFWYNEQLAFGRGLSDVDEPALWEKSLDDRVLHWIEVGQPDADRLTWCSRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVLEVLAKDMPRVIKWDVMISEGTVFVTDDRGQHEVQLQWLTGERGLast
1 -103.0002ot9_A mol:protein length:180 Hypothetical protein  ali model  100  1MAQPSTTYKFELNLTDLDRGVYESVKQTIARHPSETEERMTVRLLAYAFWYNEQLAFGRGLSDVDEPALWEKSLDDRVLHWIEVGQPDADRLTWCSRRTERTSLLAYGSLRVWEGKVIPAIKNLKNVNIAAVPQDVLEVLAKDMPRVIKWDVMISEGTVFVTDDRGQHEVQLQWLTGERG 180
2 -99.3002g3w_A mol:protein length:182 hypothetical protein XAC2396  ali model follow..  34  1MALTATVRRAELQISDMDRGYYANHSLTLAQHPSETDERLMVRLLAFALFADDRLEFGRGLSNDDEPDLWRRDYTGDPDLWIDLGQPDESRVRKACNRSREAVVIGYGATETWWKKHANAMGRYRNLRVIELDSQATEALGALIQRGMRFDVIIQDGEVQMLADHGSVTLTPMVRQAPA. 181
3 -98.7003c0u_A mol:protein length:183 Uncharacterized protein yaeQ  ali model follow..  30  3HALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLLAWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVALFTYNAAQIWWQQNQSKCVQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWLSDDKNNLEVNLTAWQQPS. 183
4 -6.5703g12_A mol:protein length:128 Putative lactoylglutathione lyase  ali model follow..  13  1MSLSLLITSITINTSHLQGGFYRIIGFQFTASKVDKGSEVHRAVLGFQITTVQELVKIPGAMCILDP---TDMPDGKKAI---VLDPDGHSIE....................................................................................... 116
5 -6.4205e3e_B mol:protein length:114 Large exoprotein involved in heme utilization  ali model follow..  14  4...........................LIDRHVGKTEAELLNRVSTGNVKSAS--SFTDRTTAEAVTSKAIDSNQAKIDSYLSGSQKGYLEID....................................................................................... 67
6 -6.2303pg6_A mol:protein length:159 E3 ubiquitin-protein ligase DTX3L  ali model follow..  23  78................................PDNKEGRKVLKLLYRA--FDQKLIFTVGYSRVLG--------VSDVITWNDIGYPDPSYLKRVKEELKAKGI............................................................................ 152
7 -6.2101egg_A mol:protein length:147 MACROPHAGE MANNOSE RECEPTOR  ali model follow..  15  36..................RDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENW-AYGEPNNYQNVEYC------GELKGDPTMSW................................................................... 123
8 -5.9104x3h_A mol:protein length:79 Activity-regulated cytoskeleton-associated pr  ali model follow..  15  14.............................................................QIFEDPREFLSHLEEYLRQ---VGGSEEYWLSQIQNHMN-------GPAKKWWEFKQGSVKNWVEFK.................................................... 70
9 -5.8503skq_A mol:protein length:249 Mitochondrial distribution and morphology pro  ali model follow..  13  86....AQMFKNDSVLDNLSRPQLAAMSKFMSLRPFGNDNMLRYQI-LKDIMNDDKTIDYEGVESLSQEEL-KEDLVDNLKVWLELRL.............................................................................................. 183
10 -5.8401hsq_A mol:protein length:71 PHOSPHOLIPASE C-GAMMA (SH3 DOMAIN)  ali model follow..  18  2.................................SPTFKCAVKALFDYKAQREDELTFIKSNVEKQEGGWWRGDYGGKKQLWF.................................................................................................. 54

FFAS is supported by the NIH grant R01-GM087218-01
1 1 4 9 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.