current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2m74_A mol:protein length:136 Fibrillin-1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst SARGGGGHDALKGPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCELast
1 -51.2002m74_A mol:protein length:136 Fibrillin-1  ali model  100  1SARGGGGHDALKGPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCE 136
2 -36.6002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  33  177HCEKALCTPRCMNGGLCVTPGFCICPPGFY----GVNCDKANCSTTCFNGTCFYPGKCICPPGLEGEQCEI---SKCPQPCRNGGKCIKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCN 307
3 -30.6004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  20  138............TLTRLRYSYRVVCSDNYYGDSCSRLCKKRDDHFG--HYECQPDGSPSCLPGWTGKYCDQPI--CLSGCHEQNGYCSPDECNCRPGWQGPLCNECIPH-KGCRHGTCTIPWQCACDEGWGGLFCD 257
4 -27.2004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  27  164GCNKFCRPRDDFFGHYCDQNGNKTCMEGWM----GPECNRAICRQGCKHGSCKLPGDCRCQYGWQGLYCDKCIPHPG---CVHGICNEPWQCLCETNWGGQLCDKDLTHQPCLNGGTCSNTGQCSCPEGYSGPNCE 303
5 -26.0005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  24  9.......SNPCANGGQCLPSYICHCPPSFHGPTCRQDVNECGQPGLCRHGGTCHNERCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTECACLPGFTGQNCEENIPGNNCKNGGACVNTYNCRCPPEWTGQYCT 156
6 -25.4005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  24  6.......SNPCANGGQCLPSYICHCPPSFHGPTCRQDVNECGEPGLCRHGGTCHNERCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTECACLPGFTGQNCEENIPGNNCKNGGACVNTYNCRCPPEWTGQYCT 153
7 -25.2004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  25  146......................................................SYRVVCSDNYYGDSCSRLCKK--RDDHFGHYECPDGSPSCLPGWTGKYCDQPICSGCHEQNGYCSKPDECNCRPGWQGPLCN 227
8 -24.8002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  20  49.................IPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE 179
9 -24.5004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  27  239.......RYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLSCTCPPGFYGKICELSAMTGPCFNGGRCSGGYSCRCPVGYSGFNCE 383
10 -24.2002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  27  23GCNKFCRPRDDFFGHYACDNGNKTCMEGWM----GPECNRAICRQGCKHGSCKLPGDCRCQYGWQGLYCDK----CIPHPGCVHGICNEPQCLCETNWGGQLCDKDLTHQPCLNGGTCSNTGQCSCPEGYSGPNCE 162
11 -22.7004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  47......LNIKSGDGGRTLTTYVGEGPIGFRATLTQSNTYAVENQWGGSSAPWHPGGTGEGPIGFKSQQADGGVYAGSSAPWHNGGVWVIGAGEGPIGFKGNSVAGNNLYITSGDNGNTFMTYSGEGPIGFRAMALP 278
12 -22.0004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  31  9...........................................ANPCEHAGKCLNTECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQQCICMPGYEGVYCEINTASSPCLHNGRCVNEFLCQCPKGFSGHLCQ 115
13 -21.5002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  32  12...........................................ANPCEHAGKCINTECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQQCICMPGYEGVHCEVNTASSPCLHNGRCLNEFQCECPTGFTGHLCQ 118
14 -20.8004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  23  189........................CEAQKWGPECNHLC------TACMNNGVCHEGECICPPGFMGRTCEKACELSGQEGCKSYVFCDPYGCSCATGWKGLQCNEACHPGSCNNGEMCDRFQGCLCSPGWQGLQCE 319
15 -20.3004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  10  36......LDIKSDDGGKTLKTYNGEGPIGFRGTLSSANNYTVENQWGGTSAPWQPGGVWV-----LGARDKQNIVA-VSIKSNDGGKTLTGNGEGPIGFKSEVTDGDTSAAPWHSGGVWVMTYNGEGPIGFRGTLTS 201
16 -20.0004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  32  1...................................DICDPNPCENGCLPGLADGSFSCECPDGFTDPNCSSVVEPCTPNPCHNGGTCEISVCKCPRGFNGIHCQHNIEVEPCKNGGICTANYSCECPGEFMGRNCQ 132
17 -18.9001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  10  47.......TSPCQNQGKCKDEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRATSSSGEAPDSITDAADLDPTENPFDLLDFNPERGDNNLTRIVGG 193
18 -18.4001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  23  14..........................................LERECIEEKCSFEEAENTEKTNEFWKQYVDGDQCEPNPCLNGGLCKDDECWCQVGFEGKNCELDAIKNGRCKQFCKTGADLCSCTTGYRLAPDQ 121
19 -17.8001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  20  1.................ANAFLEELRPGSL----ERECKEEQCSFE------AREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQICFCLPAFEGRNCETHKDDCVNENGGCEQTKRSCRCHEGYSLLADG 124
20 -17.5005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  22  138DCDGVQINVPITFQVKV-TATECIQEQSFVIRALGFTDIVTVQRSLCHGKGFLECGICRCDTGYIGKNCESCRKDNNSIICSGLGDCVCGQCLCHTSIYGQYCECDTINCERYNGQVCGGPGKCRCHPGFEGSACQ 313
21 -17.0003l95_X mol:protein length:244 Neurogenic locus notch homolog protein 1  ali model follow..  19  1..................................GSACELPECQEDAGNKVC-SLQCNNHACGWDGGDCSLNFDGHCDSQC-NSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHC-DQGCNSAECEWDGLDCA 117
22 -16.8003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  39  410......................................................................QTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCE 475
23 -15.9004um8_B mol:protein length:788 INTEGRIN BETA-6  ali model follow..  22  464.......SSKCHHGNGSFQCGVCACHPGHMGPRCEDSCKEAPDHPSCSGRGDCYCGQCICHLSIYGPYCQCDNFSCVRHKCGGNGDCDCGECVCRSGWTGEYCNCTTSTDSCVDGVLCSGRGDCVCNPGASGPTCE 615
24 -15.9005es4_B mol:protein length:727 Integrin beta-2  ali model follow..  20  434.......RSLCHGKGFLE--GICRCDTGYIGKNCEGSCRKDNNSIICSGLGDCVCGQCLCHTSIYGQYCECDTINCERYGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCSGRGRCR--NVCECHSGYQLPLCQ 591
25 -15.8001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  23  3........................................................QVICRDEKTQMIYQQH--QSWLRPVLRSNRVE--YCWCNSGRAQCHSVKSCSEPRCFNGGTCQSDFVCQCPEGFAGKSCE 85
26 -15.5001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  17  1.................ANSFLEEMKKGHLERECMEECSYEEAREVFEDSDKTNEFWNKYKDG----------DQCETSPCQNQGKCKDGTCTCLEGFEGKNCELFTRKDNGDCDQFCHNSVVCSCARGYTLADNG 121
27 -15.4002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  15  8..........................................CDNIKRLPTKPDPPQWRCNDELEPSQCTAAC-----KSCREAPGPFPGKLICEDIYWGADPGPFCTPGDCCDKAFCNKMNPPTCRCMDEVKECA 99
28 -15.0002ddu_A mol:protein length:387 reelin  ali model follow..  15  104.....................QYSHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDFEEWTRITIAEPCPSYCSGHGDCISGVCFCDLGYTAAQGTCVSNTPNHRFEGKL-SPLWYKITGGQVGTGCG 257
29 -14.9001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  23  1............................................................SKHVDGDQCLVPLEHPCASLCCGHGTCIDGSCDCRSGWEGRFCQREVSFLNCSCTHYCLGWRRCSCAPGYKLGDDL 89
30 -14.7004g1e_B mol:protein length:738 Integrin beta-3  ali model follow..  23  449..........NNGNGTFE--GVCRCGPGWLGSQCEDECSPREGQPVCSQRGECLCGQCVCHSSITGKYCECDDFSCVRYKCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMNGLLCSGRGKCECQPGSYGDTCE 599
31 -14.7002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  28  185...................................................................ECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSCSGLGDCV--GQCLCHTSIYGQYCE 274
32 -14.6001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  18  1.................ANSFLEEVKQGNLE-------------RECLEEACSLEEAEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGTCTCAEGFEGKNCEFST............................. 85
33 -14.1004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  26  2....................................................................SEKCFEPQLLRFFHKNEIWYRAVARCQCKGPDAHCQQACRTNPCLHGGRCLGHRLCHCPVGYTGPFCD 80
34 -13.8005e6r_B mol:protein length:510 Integrin beta-2  ali model follow..  12  342.SSRVFLDHNALPDTLKVT-YDSFCSNGVTHRNQPGDCDGVQINVPITFQVKVTATECIQEQSFVIRECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCEPAALQTLAQGKKKLQALKKKNAQLKWKLQALK 498
35 -13.6004neh_B mol:protein length:686 Integrin beta-2  ali model follow..  20  434.......RSLCHGKGFLE--GICRCDTGYIGKNCEGSCRKDNNSIICSGLGDCVCGQCLCHTSIYGQYCECDTINCERYNGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCSGRGRCR--NVCECHSGYQLPLCQ 591
36 -13.6001fax_L mol:protein length:96 FACTOR XA  ali model follow..  12  9.......TSPCQNQGKCKDEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEVCSCARGYTLADNGKACIPTGPYPCGKQTLE................................................. 95
37 -12.7003ltf_D mol:protein length:58 Protein spitz  ali model follow..  30  2.................................................................................................FPTYKCPETFDAWYCLNDAHCFPVYSCECAIGFMGQRCE 47
38 -12.6002e26_A mol:protein length:725 Reelin  ali model follow..  17  186....PQCEEMCYGHGSCINGTKCICDPGYSGPTCKISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLVTRDLDLSHARPDPRSQPVLLQYSLNGGL................... 312
39 -12.6003eto_A mol:protein length:242 Neurogenic locus notch homolog protein 1  ali model follow..  19  1.................................GEEACELPECQEDAGNKVC-SLQCNNHACGWDGGDCSLNFNDHCDSQC-NSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHC-DQGCNSAECEWDGLDCA 118
40 -12.1002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  17  5......CARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDSCGKFSDCWNTDCVCSPGYEPVSGAKTFKNESENTCQDVDECSSGQHQCDSS------------TVCFN---TVGSYSCRCRPGWK..... 128
41 -11.7004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  18  484..........................EAGCPLSCAVSKRRLECEECGGLGSTCSPSTKTCPDGHCDVV-ETQDINICPQDCLRGSIVGGHEPGEPRGIKA-------------GYGTCNEEEKCFCEPEIQDPLCD 603
42 -11.5001k7t_A mol:protein length:186 agglutinin isolectin 3  ali model follow..  18  2RCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCGKTCPNNHC---CSQYGHCGFGAEYCGAGCQGGPCRA---DIKCGSQAGGKLCPNNLCCSQWGYCGLGCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQ 165
43 -11.4001wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  16  2RCGEQGSNMECPNNLCCSQYGYCYCGKGC----QNGACWTSKRCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTNNYCCSCGAGCQSGGCD 170
44 -11.4001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  17  15.............NGQLVQHFKCMCNEGLVHLSENTCEEKNECKKETLGKACGEFGKCGCIEGYTLKEDTCVLDVCQYKNCGESGECISAGCSCAIGKVPNPEDEKKCTKCNTDNEVCKGVYKCQCMEGFT..... 169
45 -11.3004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  15  10........................CPRA----ACQAKRGDQRCDRECNSPGCGWDGDCSLSVGDPWRQCEALQNSRCDPACSSPACLYDNDCHAGGRERTCNPVYEKYCADHFADGRC-DQGCNTEECGWDGLDC. 123
46 -11.0002wgc_A mol:protein length:171 WHEAT GERM LECTIN  ali model follow..  16  2RCGEQGSNMECPNNLCCSQYGYCYCGKGC----QNGACWTSKRCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCSQWGFCGLGSEFCGGGCQSGACSTDKPCGKDAGGRVCTN-NYCCSKWGSCGIGPG 158
47 -10.9004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  16  332............VTSHTRPDHETKCPPREPLKNVGVVSKGKYCKPSNATAEQCGQSSADGSSLSSQVRGYHWATFVATDCNMGESCAATARGKCFFYSTVPECEDKCVSVDCGAHGTCVATGKCVCEPGFTGERCD 501
48 -10.5001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  25  1.................................................................GTSHLVKCAEKEKTFCVNGGECSRYLCKCQPGFTGARCTENV-QNQEKAEELYQK................ 67
49 -10.4003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  23  153..........................................CLASVDLNGRLPDSDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQSCDCSTSFSGPLCNDPGTTYIFSKGGGQI................. 236
50 -10.2003i08_A mol:protein length:220 Neurogenic locus notch homolog protein 1  ali model follow..  19  1.................................GEEACELPECQEDAGNKVC--SLQCNNHAGWDGGDCSLNFNDPWKN-CTQS-------LQCWKYFSDGHCDSQCNSAGCFSDGHC-DQGCNSAECEWDGLDCA 118
51 -10.2005ch1_B mol:protein length:937 putative polycomb protein Ezh2,putative polyc  ali model follow..  20  496........APCHHDGPCTAANGCPCAS--------AGTHPVLCERFCL---------CTCPLKFTGCACHSSGKTCLQ------RQREGRPCICVQ--LNRECDPTLCK-GC--GARERADPENAYDEVLHSTGCQ 598
52 -9.9202oo4_A mol:protein length:234 Neurogenic locus notch homolog protein 2  ali model follow..  13  1..................................GATCLSQYCADKARDGVC-DEACNSHACQWDGGDCSLTMENPCSSPLPINNQCDELCNTVECLFDNFECQGDKYCADHFKDNHC-NQGCNSEECGWDGLDCA 114
53 -9.8603cfw_A mol:protein length:164 L-selectin  ali model follow..  26  87.....................................................................KEDCVEIYIKRNKDAGKWNDDACHKLKAAL---CYTASCQPSCSGHGECINNYTCNCDVGYYGPQCQ 154
54 -9.6803zyj_B mol:protein length:426 NETRIN-G1  ali model follow..  21  295....................GRCKCNL-----------HATVCVYDNSKL------TCECEHNTTGPDCGKCKKNYQGRPWSPGSKGAANACISISSIGTNVCDNE--LLHCQNGGTCHNNVRCLCPAAYTGILCE 397
55 -9.5401egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  39  11............................................................................................................DGYCLNGGVCLDSYTCNCVIGYSGDRCQ 43
56 -9.4803g5c_A mol:protein length:510 ADAM 22  ali model follow..  15  310..........CFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCN 480
57 -9.4603gis_X mol:protein length:121 Thrombomodulin  ali model follow..  20  5...................................DPCFRANCEYQCQPLN-QTSYLCVCAEGFAPIPHEPHRCQLFCNQTACPADCDPNSCECPEGYILDDGFICTDIDECENGGFCPGTFECICGPDSA..... 109
58 -9.3204ux8_C mol:protein length:463 GDNF FAMILY RECEPTOR ALPHA-1  ali model follow..  15  148NCLDAA--KACNLDDTCRSAYITPCTTSMS----NEVCNRRKCHKALRQFFDKVPAFCSCRDIACTERRRQTIVPVCSYEERERPNCLSLQDSCKTNYICRSRLADFCQPESRSVSNCLKENYADCLLAYSGLIGT 290
59 -9.3105f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  39  1.......................................................................................................KNPCCSHPCQNRGVCMSVGKCDCTTGFYGENCS 38
60 -9.1901p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  36  16...............................................................................................................CLHDGVCLDKYACNCVVGYIGERCQ 45
61 -9.1801gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  42  11............................................................................................................DGYCLNGGVCLDSYTCNCVIGYSGDRCE 43
62 -9.0204mzv_A mol:protein length:248 Epithelial cell adhesion molecule  ali model follow..  17  1......................................................EEECVCENYKLAVNCFVNNNRQCQ--CTSVGAQNTVICSRAKPEGALQNNDGLYDPDCDESGQCQGTSTCWCVNTAGVRRTD 105
63 -9.0104zxb_E mol:protein length:894 Insulin receptor  ali model follow..  15  164KGKTNCPATVINGQFRCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNQPDDPTKCACRNFYLDGRCVETCPP--DWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIP----------ECPSGYTNLLCT 302

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 1 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.