current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst DSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCELast
1 -61.3002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model  100  1DSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCE 143
2 -32.0001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  21  2DVNECLDP--ISGNCVNSYICDCPPDFE-----LNPTRVGCVDTRSGN------CYLDIRPRGDNGDTACSNEIGVGVSKASCCCSNPITVILEDIDECQELPGLC-QGGKCINTFGSFQCRCPTGYYLNEDTRVCD...... 162
3 -31.2001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  24  3EASAVTDTICKNGQLVQHFKCMCNEGLVHLS------ENTCEEKNECKKETGKACGEFGQCIEQVNMYKCGCIEGYTLKEDGKVPNPEDEKKCTKTGETACQLKCNTDNEVCKNVEGVYKCQCMEGFTFDKEKNVC....... 177
4 -31.1002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  21  3DIDECESSPCINGVCKNSFICECSSEST-----LDPTKTICIETIKGTCWQTSSLGAAWGSPCTLCQVDPICGKGYSRIKGT---------QCEDIDECEVFPGVC-KNGLCVNTRGSFKCQCPSGMTLDATGRIC....... 146
5 -27.5001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  36  2..........................................DIDECRISPDLC--GRGQCVNTPGDFECKCDEGYESGF-------MMMKNCMDIDECQRDPLLC-RGGVCHNTEGSYRCECPPGHQLSPNISAC....... 85
6 -27.5001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  1.......................................APLAQQTCAN-NRHQCSVHAECRDYATGFCCRCVANYT----------GNGRQCVAEGSRVNGKVKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSYTAISTIP 95
7 -25.0001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  35  1.......................................SAVDMDECKEPDVCK---HGQCINTDGSYRCECPFGYIL----------AGNECVDTDECSVGNPCG--NGTCKNVIGGFECTCEEGFEPGPMM.......... 79
8 -24.9003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  23  3PVDPCFRA-NCEYQCQPSYLCVCAEGFAPIPH----EPHRCQLFCNQTACPADC--------DPNTQASCECPEGYIL---------DDGFICTDIDECENGGF----SGVCHNLPGTFECICGPDSALAGQIGTDCD..... 119
9 -24.2002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  22  5................SDYDIPTTENL---------YFQGAMGTNECLDNNGGC---SHVCNDLKIGYECLCPDGFQLV---------AQRRCEDIDECQDPDT----SQLCVNLEGGYKCQCEEGFQLDPHTKACK...... 101
10 -23.6001z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  27  1.........................................KDVDECSLKPSICG--TAVCKNIPGDFECECPEGYRYNL--------KSKSCEDIDECSENM-----AQLCVNYPGGYTCYCDKGFKLAQDQKSCEVVS... 87
11 -21.8001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  24  3PVDPCFRA-NCEYQCQPSYLCVCAEGFAPIPH----EPHRCQMFCNQTACPADC--------DPNTQASCECPEGYIL---------DDGFICTDIDECENGGF----SGVCHNLPGTFECICGPDSALAGQI.......... 114
12 -21.3003gcw_E mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  26  2........................................AMGTNECLDNNGGC---SYVCNDLKIGYECLCPDGFQLV---------AQRRCEDIDECQDPDT----SQLCVNLEGGYKCQCEEGFQLDPHTKACK...... 83
13 -21.0001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  16  1...............ANSFLEEMKKGHLERSDKTNEFWNKYKDGDQCETSP---CQNQGKCKDGLGEYTCTCLEGFE------------GKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPY. 130
14 -20.9001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  16  8....LERECMEETCSYEEVFEDSDKTNEFW--------NKYKDGDQCETSP---CQNQGKCKDGLGEYTCTCLEGFE------------GKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPY. 125
15 -20.7002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  17  4....................................PKHVCVDTRDI--------PKNAGCRDDDGTEEWRCLLGYKKGEG-------NTCVENNNPTCDINNGGCDPTASCQNASKKIICTCKEPTPNAYEGVFCSSSS... 99
16 -20.4002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  17  4....................................PKHVCVDTRDI--------PKNAGCFDDDGTKEWRCLLGYKKGEG-------NTCVENNNPTCDINNGGCDPTASCQNAESTIICTCKEPTPNAYEGVFCSSSS... 99
17 -20.2002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  4DVDECANPCEHAGKCIGSFECQCLQGYTGPR----------IDVNECVSNP---CQNDATCLDQIGEFQCICMPGYE------------GVHCENTDECASSP--CLHNGRCLDKINEFQCECPTGFT---GHLCQVDLHHIL 125
18 -20.2004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  26  1DVDECANPCEHAGKCLGSFECQCLQGYTGPR----------IDVNECISNP---CQNDATCLDQIGEFQCICMPGYE------------GVYCENTDECASSP--CLHNGRCVDKINEFLCQCPKGFS---GHLCQSGRLEVL 122
19 -19.8001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  24  2DPDGCSNPCFPGAQCSSSWSCFCPVGFLG-------NGTHCEDLDECALVPDISTSKVPRCVNTQPGFHCPCPPRYRGNQVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYSDPMYKCECQTGYAGDG............ 141
20 -19.5005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  25  3QADPCSNPCANGGQCLASYICHCPPSFHGPT----------QDVNECGQKPG-LCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPPGNNCKNGGACVDGVNTYNCRCPPEWT............... 151
21 -18.7001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  15  1..........................................NISQHQCVKKQ-CPQNSGCFHLDEREECKCLLNYK----------QEGDKCVENPNCNENNGGCDADAKCTEEGKKITCECTKPDSYPFDGIFCSSSN... 96
22 -18.7001fax_L mol:protein length:96 FACTOR XA  ali model follow..  21  2.........................................KDGDQCETSP---CQNQGKCKDGLGEYTCTCLEGFE------------GKNCELFTRKLCSLDNGDCDQFCHEEQASVVCSCARGYTLADNGKACIPTGP.. 86
23 -18.4001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  15  14....LERECIEEKCSFEEVFENTEKTNEFW--------KQYVDGDQCEPNP---CLNGGLCKDDINSYECWCQVGFE------------GKNCEDATCNIKNG--RCKQFCKTGADSKVLCSCTTGYRLAPDQKSCKP..... 126
24 -18.4004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  32NVVALDIKSDDGGKTLMTYNGEGPIGFRGTENQWGGTSAPWQPGGVWVLGARIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDTYSVENQWGGSAAPWHSGDAKSNDGGKTLSGTMTYNGEGPIGFRGT............. 198
25 -18.3005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  2..DPCSNPCANGGQCLASYICHCPPSFHGPT----------QDVNECGEKPG-LCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPPGNNCKNGGACVDGVNTYNCRCPPEWT............... 148
26 -18.3001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  23  5..........................................DGDQCLVLPASLCCGHGTCIDGIGSFSCDCRSGWE------------GRFCQEVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK.. 97
27 -17.9001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  17  1..........................................NISQHQCVKKQ-CPQNSGCFHLDEREECKCLLNYK----------QEGDKCVENPNCNENNGGCDADAKCTEEGKKITCECTKPDSYPLFD.......... 88
28 -17.6001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  12  3....................................EASNMSSAHKCIDTN---VPENAACYRYLGTEEWRCLLGFK----------EVGGKCVPASTCEENNGGCAPEAECTMDDKEVECKCTKEGSELFEGVFCSSSS... 97
29 -17.6002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  21  1.........................................SDVNECLT-IPEACKGEMKCINHYGGYLCLPRSAAVINDLH------------------------GEGPPPPVPPAQHPNPCPPGYEPDDQD-SCVD..... 71
30 -17.4004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  10  110QVVALDIESGDQGATLATYAGEGPIGFKSQENQWGGSSAPWHNGGVWVIGARIGSTDSGKTLNGNMTYAGEGPIGFKGNSVAGNNYAVENQWGGTSAPWHPGYITSGDNGNTFHGSMTYSGEGPIGFRAM............. 275
31 -17.3004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  25  385KIDYCSSPCSNGAKCVDAYLCRCQAGFSG---------RHCDNVDDCASSP---CANGGTCRDGVNDFSCTCPPGYT------------GRNCSPVSRCEHAP--CHNGATCHQRGHGYVCECARSYG---GPNCQFLLPELP 504
32 -17.2004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  22  205.....QGCSPKHGSCKLPGDCRCQYGWQG---------------LYCDKCIPHPGCVHGICNE---PWQCLCETNWG------------GQLCDKDLNYCGTHQPCLNGGTCSNTPDKYQCSCPEGYSGP----------NCE 303
33 -17.2002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  16  1.......................................TMSSEHTCIDTN---VPDNAACYRYLGTEEWRCLLTFK----------EEGGKCVPASTCKDNNGGCAPEAECKMTSNKIVCKCTKEGS............... 80
34 -17.1004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  21  1..DICPNPCENGGICLGSFSCECPDGFTDPNCSSVSDEEEPTSAGPCTPNP---CHNGGTCEDTFIGYVCKCPRGFN------------GIHCQNINECEVEP--CKNGGICTDLVANYSCECPGEFM............... 127
35 -16.6001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  13  2.........................................SSEHRCIDTN---VPENAACYRYDGTEEWRCLLYFK----------EDAGKCVPAPNCKDKNGGCAPEAECKMNKNEIVCKCTKEGSEPLFE.......... 84
36 -16.2001dqb_A mol:protein length:83 THROMBOMODULIN  ali model follow..  20  1.......................................HMEPVDPCFRAN------EYQCQPNQTSYLCVCAEGFAPIP-------HEPHRCQMFCNQTACPADC-------DPNTQASCECPEGYILDDGF-ICTDIDE.. 83
37 -15.4001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  17  1...............ANAFLEELRPGSLERECKEEQCSFEYSDGDQCASSP---CQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNEN-----------GCEQYCSDHTGTRSCRCHEGYSLLADGVSCTP..... 129
38 -15.0002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  21  64.....QGCSPKHGSCKLPGDCRCQYGWQG---------------LYCDKCIPHPGCVHGICNE---PWQCLCETNWG------------GQLCDKDLNYCGTHQPCLNGGTCSNTPDKYQCSCPEGYS............... 157
39 -14.8002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  21  147QQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPSTTCFNCFYPGKCICPPGLEGEQCEISKCPQNGGKCIGKSKCPVCEPGCGAHGTCHE---PNKCQCQEGWHGRH............ 305
40 -14.8003v65_B mol:protein length:386 Low-density lipoprotein receptor-related prot  ali model follow..  26  1.........................................TGEENCNVNNG---GCAQKCQMIRGAVQCTCHTGYRLTE--------DGRTCQDVNECA-EEGYCSQ--GCTNSEGAFQCWCEAGYELRPDRRSCKALGP.. 86
41 -14.7004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  23  157..DSCSRLCKKHYECQPDGSPSCLPGWTG---------KYC-DQPICL---SGCHEQNGYCSK---PDECNCRPGWQ------------GPLC---NECIPHK--GCRHGTCTI---PWQCACDEGWGGL............. 254
42 -14.0004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  20  196..PECNHLCTNNGVCHETGECICPPGFMGRTCEKACEGRTCKERCSGQEG----CKSYVFCLPDPYG--CSCATGWKGLQCNEACHPGFGPDCK--LRCS-----CNNGEMCDRFQG---CLCSPGWQGLQCEREG....... 322
43 -13.8001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  18  1...............ANSFLEEVKQGNLERE-----------------------CLEEACSLEEAREVFEDAEQTDEFWSKY-----------KDGDQCEGHP--CLNQGHCKDGIGDYTCTCAEGFEGK............. 79
44 -13.6003kl6_B mol:protein length:57 Coagulation Factor X light chain  ali model follow..  18  2.............................................................................................RARKLCSLDNGDCDQ--FCHEEQNSVVCSCARGYTLADNGKACIPTGPYP 49
45 -13.0001apq_A mol:protein length:53 COMPLEMENT PROTEASE C1R  ali model follow..  35  1............................................................................................AVDLDECASRSKSGEEDPQCHNYVGGYFCSCRPGYELQEDRHSCQ...... 51
46 -12.8002gd4_L mol:protein length:58 Coagulation factor X, Stuart factor, Stuart-P  ali model follow..  19  2...............................................................................................RKLCSLDNGDCDQ--FCHEEQNSVVCSCARGYTLADNGKACIPTGPYP 47
47 -12.7004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  21  137........NNTLTRLRYSYRVVCSDNYYGDS---------CSRL----CKKRDDHFGHYECQP---DGSPSCLPGWT------------GKYC-DQPICLSGC--HEQNGYCSK---PDECNCRPGWQGP----------LCN 227
48 -12.6004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  16  4.........................................KCFEPQLLRF---FHKNEIWYRTEQAAVARCQCKG------------PDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYT............... 75
49 -12.1002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  17  7....GHDALKGPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRH----------SCGDGFCSRPN----MCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGSGCLNCVAPNRCACTYGFT............... 131
50 -11.7003u3p_A mol:protein length:313 Tumor necrosis factor receptor superfamily me  ali model follow..  17  27..DKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRE----CTCPPGMFQSNA----------TCAPHTVCPVGWGVRKKGTETEDVR----CKCARGTDVPSSVMKCKAYTDCL 152
51 -11.5003s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  12  563........................................................................................NVHRVIGSNPCAEENGGCSH--LCLYRPQGLRCACPIGFELISDMKTCI...... 609
52 -11.0003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  20  3.........................................KGGSPCISQP---CLHNGSCQDSIWGYTCTCSPGY------------EGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQCV...... 83
53 -10.8001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  14  1.................SYQVICRDEKTQMI-----------QQHQSWLRP---------VLRSNRVEYCWCNSGRA------------QCHSVPVKSCSEPR--CFNGGTCQQALSDFVCQCPEGFAGK............. 82
54 -10.6004yzu_B mol:protein length:62 Coagulation factor IX  ali model follow..  14  2...............................................................................................DVTCNIKNGRCEQ--FCKNSANKVVCSCTEGYRLAENQKSCEPAVPFP 48
55 -10.4003soq_A mol:protein length:318 Low-density lipoprotein receptor-related prot  ali model follow..  14  265.............................................................................................NATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGNS.. 312
56 -10.2003v64_C mol:protein length:349 agrin  ali model follow..  14  302.............................................................................................AGKNRCGDNNGGCTH--LCLPSGQNYTCACPTGFRKI-NSHACALEVLFQ 348
57 -10.1003s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  16  256........................................................................................HSSRQSGWNECASSNGHCSH--LCLAVPGGFVCGCPAHYSLNADNRTCSAPTTF. 308
58 -9.5404zxb_E mol:protein length:894 Insulin receptor  ali model follow..  17  165....GKTNCPATVRCWTHSHCQKVCPTICKSHGCTAEGLCCHS--ECQPDDPTKC---VACRNFYLDGRCTCPPPYYHF---------QDWRCVNFSFCQDLHHKCKNSRRHQYVIHNNKCECPSGYTMNSSNLLCT---PCL 305
59 -9.5302ok5_A mol:protein length:752 Complement factor B  ali model follow..  17  35..QALEYVCPSGFYPYPVQTRTCRSTGSWSTLKTQVRKAECRAI-HCPRPHDFENGPRSPYYNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGHCLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYD 204
60 -9.5103cfw_A mol:protein length:164 L-selectin  ali model follow..  28  105..........NDDACHKLKAALCYT----------------------ASCQPWSCSGHGECVEIINNYTCNCDVGYY------------GPQCQFVQVDPR.......................................... 161
61 -9.4104ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  17  498..LECEECGGLGSP---TGRCEWRQG---DGKGITRNFSTCSSTKTC---------PDGHCDVVETQDINICPQDCL------------RGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPE---DIQDPLCDEL--CR 607
62 -9.4002ra0_L mol:protein length:51 Coagulation factor X  ali model follow..  20  2..................................................................................................CSLDNGDCDQ--FCHEEQNSVVCSCARGYTLADNGKACIPTGPYP 44
63 -9.3703s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  18  260.............................................................................................SGWNECASSNGHCSH--LCLAVPGGFVCGCPAHYSLNADNRTCSAPTTF. 307
64 -9.3204a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  13  580................................................................................................HPCAQDNGGCSH--ICLVKGGTTRCSCPMHLVLLQDELSCGGTK... 622
65 -9.3104mzv_A mol:protein length:248 Epithelial cell adhesion molecule  ali model follow..  17  2..EECVCENYKLAVNCFNRQCQCTSVGAQNTVICSKLAAKCMKAEMQGSKLGRRAKPEGALQNNDGLYDPDCDES-------------KAKQCQGTSTC------------CVNTAGV......................... 101
66 -9.2505e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  19  198........CHGKGFLECG-ICRCDTGYIGKNCECQTQGRSSQELEGSKDNNSIICSGLGDCV------QCLCHTSDVPGK--------YGQYC----ECDTINCERYNGQVCGGPGRG-KCRCHPGFEG----------SACQ 313
67 -9.2101kig_L mol:protein length:51 FACTOR XA  ali model follow..  18  1..................................................................................................CSLDNGGCDQ--FCREERSEVRCSCAHGYVLGDDSKSCVSTERFP 43
68 -9.1403c9a_A mol:protein length:223 Protein giant-lens  ali model follow..  16  21DSEEDLPVCAPNAVCSKIDLCRCPDGRTCPSSLGVEDGHTCQPVHKCKRDYTWTLTTAAELNVTEQIVHCRCPRNSVTYLTKREPIGNDSPGYRYLFACSPLTLRCQRKQPCKLFTVNSLCQCPKGHRCPSHHTQSGVIAG.. 198

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;